LHFPL2 (NM_005779) Human Mass Spec Standard
CAT#: PH314880
LHFPL2 MS Standard C13 and N15-labeled recombinant protein (NP_005770)
View other "LHFPL2" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | LHFPL2 MS Standard C13 and N15-labeled recombinant protein (NP_005770) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC214880 |
Predicted MW | 24.3 kDa |
Protein Sequence |
>RC214880 representing NM_005779
Red=Cloning site Green=Tags(s) MCHVIVTCRSMLWTLLSIVVAFAELIAFMSADWLIGKARSRGGVEPAGPGGGSPEPYHPTLGIYARCIRN PGVQHFQRDTLCGPYAESFGEIASGFWQATAIFLAVGIFILCMVALVSVFTMCVQSIMKKSIFNVCGLLQ GIAGLFLILGLILYPAGWGCQKAIDYCGHYASAYKPGDCSLGWAFYTAIGGTVLTFICAVFSAQAEIATS SDKVQEEIEEGKNLICLL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_005770 |
RefSeq Size | 4448 |
RefSeq ORF | 684 |
Locus ID | 10184 |
Cytogenetics | 5q14.1 |
Summary | This gene is a member of the lipoma HMGIC fusion partner (LHFP) gene family, which is a subset of the superfamily of tetraspan transmembrane protein encoding genes. Mutations in one LHFP-like gene result in deafness in humans and mice, and a second LHFP-like gene is fused to a high-mobility group gene in a translocation-associated lipoma. Alternatively spliced transcript variants have been found, but their biological validity has not been determined. [provided by RefSeq, Jul 2008] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417067 | LHFPL2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY417067 | Transient overexpression lysate of lipoma HMGIC fusion partner-like 2 (LHFPL2) |
CNY 3080.00 |
|
TP314880 | Recombinant protein of human lipoma HMGIC fusion partner-like 2 (LHFPL2), 20 µg |
CNY 2900.00 |