BATF3 (NM_018664) Human Mass Spec Standard
CAT#: PH315000
BATF3 MS Standard C13 and N15-labeled recombinant protein (NP_061134)
View other "BATF3" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | BATF3 MS Standard C13 and N15-labeled recombinant protein (NP_061134) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC215000 |
| Predicted MW | 14.5 kDa |
| Protein Sequence |
>RC215000 protein sequence
Red=Cloning site Green=Tags(s) MSQGLPAAGSVLQRSVAAPGNQPQPQPQQQSPEDDDRKVRRREKNRVAAQRSRKKQTQKADKLHEEYESL EQENTMLRREIGKLTEELKHLTEALKEHEKMCPLLLCPMNFVPVPPRPDPVAGCLPR myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_061134 |
| RefSeq Size | 992 |
| RefSeq ORF | 381 |
| Synonyms | JDP1; JUNDM1; SNFT |
| Locus ID | 55509 |
| Cytogenetics | 1q32.3 |
| Summary | This gene encodes a member of the basic leucine zipper protein family. The encoded protein functions as a transcriptional repressor when heterodimerizing with JUN. The protein may play a role in repression of interleukin-2 and matrix metalloproteinase-1 transcription.[provided by RefSeq, Feb 2009] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC412970 | BATF3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY412970 | Transient overexpression lysate of basic leucine zipper transcription factor, ATF-like 3 (BATF3) |
CNY 3080.00 |
|
| TP315000 | Recombinant protein of human basic leucine zipper transcription factor, ATF-like 3 (BATF3), 20 µg |
CNY 2900.00 |
