SSBP1 (NM_003143) Human Mass Spec Standard
CAT#: PH315106
SSBP1 MS Standard C13 and N15-labeled recombinant protein (NP_003134)
View other "SSBP1" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | SSBP1 MS Standard C13 and N15-labeled recombinant protein (NP_003134) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC215106 |
Predicted MW | 17.26 kDa |
Protein Sequence |
>RC215106 representing NM_003143
Red=Cloning site Green=Tags(s) MFRRPVLQVLRQFVRHESETTTSLVLERSLNRVHLLGRVGQDPVLRQVEGKNPVTIFSLATNEMWRSGDS EVYQLGDVSQKTTWHRISVFRPGLRDVAYQYVKKGSRIYLEGKIDYGEYMDKNNVRRQATTIIADNIIFL SDQTKEKE myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_003134 |
RefSeq Size | 628 |
RefSeq ORF | 444 |
Synonyms | Mt-SSB; mtSSB; SOSS-B1; SSBP |
Locus ID | 6742 |
Cytogenetics | 7q34 |
Summary | SSBP1 is a housekeeping gene involved in mitochondrial biogenesis (Tiranti et al., 1995 [PubMed 7789991]). It is also a subunit of a single-stranded DNA (ssDNA)-binding complex involved in the maintenance of genome stability (Huang et al., 2009) [PubMed 19683501].[supplied by OMIM, Feb 2010] |
Protein Families | Druggable Genome |
Protein Pathways | DNA replication, Homologous recombination, Mismatch repair |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401092 | SSBP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401092 | Transient overexpression lysate of single-stranded DNA binding protein 1 (SSBP1) |
CNY 3080.00 |
|
TP315106 | Recombinant protein of human single-stranded DNA binding protein 1 (SSBP1), 20 µg |
CNY 2900.00 |