IL21 (NM_021803) Human Mass Spec Standard
CAT#: PH315235
IL21 MS Standard C13 and N15-labeled recombinant protein (NP_068575)
View other "IL21" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | IL21 MS Standard C13 and N15-labeled recombinant protein (NP_068575) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC215235 |
| Predicted MW | 18.5 kDa |
| Protein Sequence |
>RC215235 representing NM_021803
Red=Cloning site Green=Tags(s) MRSSPGNMERIVICLMVIFLGTLVHKSSSQGQDRHMIRMRQLIDIVDQLKNYVNDLVPEFLPAPEDVETN CEWSAFSCFQKAQLKSANTGNNERIINVSIKKLKRKPPSTNAGRRQKHRLTCPSCDSYEKKPPKEFLERF KSLLQKMIHQHLSSRTHGSEDS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_068575 |
| RefSeq Size | 642 |
| RefSeq ORF | 486 |
| Synonyms | CVID11; IL-21; Za11 |
| Locus ID | 59067 |
| Cytogenetics | 4q27 |
| Summary | This gene encodes a member of the common-gamma chain family of cytokines with immunoregulatory activity. The encoded protein plays a role in both the innate and adaptive immune responses by inducing the differentiation, proliferation and activity of multiple target cells including macrophages, natural killer cells, B cells and cytotoxic T cells. Dysregulation of this gene plays a role in multiple immune-mediated diseases including lupus, psoriasis and chronic inflammatory diseases. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Dec 2011] |
| Protein Families | Druggable Genome, Secreted Protein |
| Protein Pathways | Cytokine-cytokine receptor interaction, Jak-STAT signaling pathway |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC411922 | IL21 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY411922 | Transient overexpression lysate of interleukin 21 (IL21) |
CNY 3080.00 |
|
| TP315235 | Recombinant protein of human interleukin 21 (IL21), 20 µg |
CNY 2900.00 |
|
| TP721084 | Purified recombinant protein of Human interleukin 21 (IL21), transcript variant 1 |
CNY 1800.00 |
|
| TP723716 | Purified recombinant protein of Human interleukin 21 (IL21), transcript variant 1 |
CNY 5150.00 |
