IGFL1 (NM_198541) Human Mass Spec Standard
CAT#: PH315281
IGFL1 MS Standard C13 and N15-labeled recombinant protein (NP_940943)
View other "IGFL1" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | IGFL1 MS Standard C13 and N15-labeled recombinant protein (NP_940943) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC215281 |
Predicted MW | 12.2 kDa |
Protein Sequence |
>RC215281 representing NM_198541
Red=Cloning site Green=Tags(s) MAPRGCIVAVFAIFCISRLLCSHGAPVAPMTPYLMLCQPHKRCGDKFYDPLQHCCYDDAVVPLARTQTCG NCTFRVCFEQCCPWTFMVKLINQNCDSARTSDDRLCRSVS myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_940943 |
RefSeq Size | 771 |
RefSeq ORF | 330 |
Synonyms | APRG644; UNQ644 |
Locus ID | 374918 |
Cytogenetics | 19q13.32 |
Summary | The protein encoded by this gene is a member of the insulin-like growth factor family of signaling molecules. The encoded protein is synthesized as a precursor protein and is proteolytically cleaved to form a secreted mature peptide. The mature peptide binds to a receptor, which in mouse was found on the cell surface of T cells. Increased expression of this gene may be linked to psoriasis. [provided by RefSeq, Aug 2016] |
Protein Families | Secreted Protein, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403685 | IGFL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403685 | Transient overexpression lysate of IGF-like family member 1 (IGFL1) |
CNY 3080.00 |
|
TP315281 | Recombinant protein of human IGF-like family member 1 (IGFL1), 20 µg |
CNY 2900.00 |