G0 Protein alpha (GNAO1) (NM_138736) Human Mass Spec Standard
CAT#: PH315437
GNAO1 MS Standard C13 and N15-labeled recombinant protein (NP_620073)
View other "G0 Protein alpha" proteins (7)
| 
                   Need it in bulk or customized?  Get a free quote  | 
                    
CNY 19520.00
Specifications
| Product Data | |
| Description | GNAO1 MS Standard C13 and N15-labeled recombinant protein (NP_620073) | 
| Species | Human | 
| Expression Host | HEK293 | 
| Expression cDNA Clone or AA Sequence | RC215437 | 
| Predicted MW | 40.1 kDa | 
| Protein Sequence | 
                 >RC215437 protein sequence 
Red=Cloning site Green=Tags(s) MGCTLSAEERAALERSKAIEKNLKEDGISAAKDVKLLLLGAGESGKSTIVKQMKIIHEDGFSGEDVKQYK PVVYSNTIQSLAAIVRAMDTLGIEYGDKERKADAKMVCDVVSRMEDTEPFSAELLSAMMRLWGDSGIQEC FNRSREYQLNDSAKYYLDSLDRIGAADYQPTEQDILRTRVKTTGIVETHFTFKNLHFRLFDVGGQRSERK KWIHCFEDVTAIIFCVALSGYDQVLHEDETTNRMHESLKLFDSICNNKWFTDTSIILFLNKKDIFEEKIK KSPLTICFPEYTGPSAFTEAVAYIQAQYESKNKSAHKEIYTHVTCATDTNNIQFVFDAVTDVIIAKNLRG CGLY myc-FLAG tag  | 
        
| Tag | C-Myc/DDK | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Concentration | >0.05 µg/µL as determined by microplate BCA method | 
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 | 
| Reference Data | |
| RefSeq | NP_620073 | 
| RefSeq Size | 6061 | 
| RefSeq ORF | 1062 | 
| Synonyms | DEE17; EIEE17; G-ALPHA-o; GNAO; HLA-DQB1; NEDIM | 
| Locus ID | 2775 | 
| Cytogenetics | 16q13 | 
| Summary | The protein encoded by this gene represents the alpha subunit of the Go heterotrimeric G-protein signal-transducing complex. Defects in this gene are a cause of early-onset epileptic encephalopathy. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2015] | 
| Protein Families | Druggable Genome | 
| Protein Pathways | Long-term depression, Melanogenesis | 
Documents
| FAQs | 
| SDS | 
Resources
| 蛋白相关资源 | 
Other Versions
| SKU | Description | Size | Price | 
|---|---|---|---|
| LC402819 | GNAO1 HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 900.00  | 
                                            |
| LC408500 | GNAO1 HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 900.00  | 
                                            |
| LY402819 | Transient overexpression lysate of guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O (GNAO1), transcript variant 1 | 
                                                     CNY 3080.00  | 
                                            |
| LY408500 | Transient overexpression lysate of guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O (GNAO1), transcript variant 2 | 
                                                     CNY 3080.00  | 
                                            |
| PH317958 | GNAO1 MS Standard C13 and N15-labeled recombinant protein (NP_066268) | 
                                                     CNY 19520.00  | 
                                            |
| TP315437 | Recombinant protein of human guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O (GNAO1), transcript variant 2, 20 µg | 
                                                     
                                                        
                                                        
                                                        
                                                            CNY 2900.00  | 
                                            |
| TP317958 | Recombinant protein of human guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O (GNAO1), transcript variant 1, 20 µg | 
                                                     
                                                        
                                                        
                                                        
                                                            CNY 2900.00  | 
                                            
其它G0 Protein alpha产品
