G0 Protein alpha (GNAO1) (NM_138736) Human Mass Spec Standard
CAT#: PH315437
GNAO1 MS Standard C13 and N15-labeled recombinant protein (NP_620073)
View other "G0 Protein alpha" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | GNAO1 MS Standard C13 and N15-labeled recombinant protein (NP_620073) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC215437 |
Predicted MW | 40.1 kDa |
Protein Sequence |
>RC215437 protein sequence
Red=Cloning site Green=Tags(s) MGCTLSAEERAALERSKAIEKNLKEDGISAAKDVKLLLLGAGESGKSTIVKQMKIIHEDGFSGEDVKQYK PVVYSNTIQSLAAIVRAMDTLGIEYGDKERKADAKMVCDVVSRMEDTEPFSAELLSAMMRLWGDSGIQEC FNRSREYQLNDSAKYYLDSLDRIGAADYQPTEQDILRTRVKTTGIVETHFTFKNLHFRLFDVGGQRSERK KWIHCFEDVTAIIFCVALSGYDQVLHEDETTNRMHESLKLFDSICNNKWFTDTSIILFLNKKDIFEEKIK KSPLTICFPEYTGPSAFTEAVAYIQAQYESKNKSAHKEIYTHVTCATDTNNIQFVFDAVTDVIIAKNLRG CGLY myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_620073 |
RefSeq Size | 6061 |
RefSeq ORF | 1065 |
Synonyms | DEE17; EIEE17; G-ALPHA-o; GNAO; HLA-DQB1; NEDIM |
Locus ID | 2775 |
Cytogenetics | 16q13 |
Summary | The protein encoded by this gene represents the alpha subunit of the Go heterotrimeric G-protein signal-transducing complex. Defects in this gene are a cause of early-onset epileptic encephalopathy. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2015] |
Protein Families | Druggable Genome |
Protein Pathways | Long-term depression, Melanogenesis |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402819 | GNAO1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC408500 | GNAO1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402819 | Transient overexpression lysate of guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O (GNAO1), transcript variant 1 |
CNY 3080.00 |
|
LY408500 | Transient overexpression lysate of guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O (GNAO1), transcript variant 2 |
CNY 3080.00 |
|
PH317958 | GNAO1 MS Standard C13 and N15-labeled recombinant protein (NP_066268) |
CNY 19520.00 |
|
TP315437 | Recombinant protein of human guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O (GNAO1), transcript variant 2, 20 µg |
CNY 2900.00 |
|
TP317958 | Recombinant protein of human guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O (GNAO1), transcript variant 1, 20 µg |
CNY 2900.00 |
其它G0 Protein alpha产品