Syntenin (SDCBP) (NM_001007068) Human Mass Spec Standard
CAT#: PH315442
SDCBP MS Standard C13 and N15-labeled recombinant protein (NP_001007069)
View other "Syntenin" proteins (14)
Need it in bulk or customized? Get a free quote |
CNY 14250.00
CNY 1999.00
CNY 2700.00
CNY 3080.00
Specifications
Product Data | |
Description | SDCBP MS Standard C13 and N15-labeled recombinant protein (NP_001007069) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC215442 |
Predicted MW | 31.6 kDa |
Protein Sequence |
>RC215442 representing NM_001007068
Red=Cloning site Green=Tags(s) MSLYPSLEDLKAQTAFSANPANPAILSEASAPIPHDGNLYPRLYPELSQYMGLSLNEEEIRANVAVVSGA PLQGQLVARPSSINYMVAPVTGNDVGIRRAEIKQGIREVILCKDQDGKIGLRLKSIDNGIFVQLVQANSP ASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQAFGEKITMTIRDRPFERTITMHKDSTGHVGFIFKNG KITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPAFIFEHIIKRMAPSI MKSLMDHTIPEV myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001007069 |
RefSeq Size | 2155 |
RefSeq ORF | 876 |
Synonyms | MDA-9; MDA9; ST1; SYCL; TACIP18 |
Locus ID | 6386 |
Cytogenetics | 8q12.1 |
Summary | The protein encoded by this gene was initially identified as a molecule linking syndecan-mediated signaling to the cytoskeleton. The syntenin protein contains tandemly repeated PDZ domains that bind the cytoplasmic, C-terminal domains of a variety of transmembrane proteins. This protein may also affect cytoskeletal-membrane organization, cell adhesion, protein trafficking, and the activation of transcription factors. The protein is primarily localized to membrane-associated adherens junctions and focal adhesions but is also found at the endoplasmic reticulum and nucleus. Alternative splicing results in multiple transcript variants encoding different isoforms. Related pseudogenes have been identified on multiple chromosomes. [provided by RefSeq, Jan 2017] |
Protein Families | Druggable Genome, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417182 | SDCBP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC423571 | SDCBP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC423572 | SDCBP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC425198 | SDCBP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY417182 | Transient overexpression lysate of syndecan binding protein (syntenin) (SDCBP), transcript variant 1 |
CNY 3080.00 |
|
LY423571 | Transient overexpression lysate of syndecan binding protein (syntenin) (SDCBP), transcript variant 2 |
CNY 3080.00 |
|
LY423572 | Transient overexpression lysate of syndecan binding protein (syntenin) (SDCBP), transcript variant 3 |
CNY 3080.00 |
|
LY425198 | Transient overexpression lysate of syndecan binding protein (syntenin) (SDCBP), transcript variant 2 |
CNY 3080.00 |
|
PH312681 | SDCBP MS Standard C13 and N15-labeled recombinant protein (NP_001007068) |
CNY 14250.00 |
|
PH315390 | SDCBP MS Standard C13 and N15-labeled recombinant protein (NP_005616) |
CNY 19520.00 |
|
TP312681 | Purified recombinant protein of Homo sapiens syndecan binding protein (syntenin) (SDCBP), transcript variant 2, 20 µg |
CNY 2900.00 |
|
TP315390 | Recombinant protein of human syndecan binding protein (syntenin) (SDCBP), transcript variant 1, 20 µg |
CNY 2900.00 |
|
TP315442 | Purified recombinant protein of Homo sapiens syndecan binding protein (syntenin) (SDCBP), transcript variant 3, 20 µg |
CNY 2900.00 |
|
TP720983 | Purified recombinant protein of Human syndecan binding protein (syntenin) (SDCBP), transcript variant 5 |
CNY 1800.00 |
其它Syntenin产品