LARP6 (NM_197958) Human Mass Spec Standard
CAT#: PH315460
LARP6 MS Standard C13 and N15-labeled recombinant protein (NP_932062)
View other "LARP6" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 14250.00
Specifications
Product Data | |
Description | LARP6 MS Standard C13 and N15-labeled recombinant protein (NP_932062) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC215460 |
Predicted MW | 9.6 kDa |
Protein Sequence |
>RC215460 representing NM_197958
Red=Cloning site Green=Tags(s) MAQSGGEARPGPKTAVQIRVAIQEAEDVDELEDEEEGAETRGAGDPARYLSPGWGSASEEEPSRGHRNRS SVNSRTMLASFIVSSAPSTAPST myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_932062 |
RefSeq Size | 577 |
RefSeq ORF | 279 |
Synonyms | ACHN |
Locus ID | 55323 |
Cytogenetics | 15q23 |
Summary | Regulates the coordinated translation of type I collagen alpha-1 and alpha-2 mRNAs, CO1A1 and CO1A2. Stabilizes mRNAs through high-affinity binding of a stem-loop structure in their 5' UTR. This regulation requires VIM and MYH10 filaments, and the helicase DHX9.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405156 | LARP6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY405156 | Transient overexpression lysate of La ribonucleoprotein domain family, member 6 (LARP6), transcript variant 2 |
CNY 3080.00 |
|
TP315460 | Recombinant protein of human La ribonucleoprotein domain family, member 6 (LARP6), transcript variant 2, 20 µg |
CNY 2900.00 |