FGFR3 (NM_000142) Human Mass Spec Standard
CAT#: PH315533
FGFR3 MS Standard C13 and N15-labeled recombinant protein (NP_000133)
View other "FGFR3" proteins (7)
| 
                   Need it in bulk or customized?  Get a free quote  | 
                    
CNY 19520.00
CNY 4840.00
                                                
                                                
                                                
                                                    CNY 1999.00 
                                                    
                                                    CNY 2700.00
                                                
                                            
Specifications
| Product Data | |
| Description | FGFR3 MS Standard C13 and N15-labeled recombinant protein (NP_000133) | 
| Species | Human | 
| Expression Host | HEK293 | 
| Expression cDNA Clone or AA Sequence | RC215533 | 
| Predicted MW | 87.71 kDa | 
| Protein Sequence | 
                 >RC215533 representing NM_000142 
Red=Cloning site Green=Tags(s) MGAPACALALCVAVAIVAGASSESLGTEQRVVGRAAEVPGPEPGQQEQLVFGSGDAVELSCPPPGGGPMG PTVWVKDGTGLVPSERVLVGPQRLQVLNASHEDSGAYSCRQRLTQRVLCHFSVRVTDAPSSGDDEDGEDE AEDTGVDTGAPYWTRPERMDKKLLAVPAANTVRFRCPAAGNPTPSISWLKNGREFRGEHRIGGIKLRHQQ WSLVMESVVPSDRGNYTCVVENKFGSIRQTYTLDVLERSPHRPILQAGLPANQTAVLGSDVEFHCKVYSD AQPHIQWLKHVEVNGSKVGPDGTPYVTVLKTAGANTTDKELEVLSLHNVTFEDAGEYTCLAGNSIGFSHH SAWLVVLPAEEELVEADEAGSVYAGILSYGVGFFLFILVVAAVTLCRLRSPPKKGLGSPTVHKISRFPLK RQVSLESNASMSSNTPLVRIARLSSGEGPTLANVSELELPADPKWELSRARLTLGKPLGEGCFGQVVMAE AIGIDKDRAAKPVTVAVKMLKDDATDKDLSDLVSEMEMMKMIGKHKNIINLLGACTQGGPLYVLVEYAAK GNLREFLRARRPPGLDYSFDTCKPPEEQLTFKDLVSCAYQVARGMEYLASQKCIHRDLAARNVLVTEDNV MKIADFGLARDVHNLDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLLWEIFTLGGSPYPGIPV EELFKLLKEGHRMDKPANCTHDLYMIMRECWHAAPSQRPTFKQLVEDLDRVLTVTSTDEYLDLSAPFEQY SPGGQDTPSSSSSGDDSVFAHDLLPPAPPSSGGSRT TRRLEQKLISEEDLAANDILDYKDDDDKV  | 
        
| Tag | C-Myc/DDK | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Concentration | >0.05 µg/µL as determined by microplate BCA method | 
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 | 
| Reference Data | |
| RefSeq | NP_000133 | 
| RefSeq Size | 4093 | 
| RefSeq ORF | 2418 | 
| Synonyms | ACH; CD333; CEK2; HSFGFR3EX; JTK4 | 
| Locus ID | 2261 | 
| Cytogenetics | 4p16.3 | 
| Summary | This gene encodes a member of the fibroblast growth factor receptor (FGFR) family, with its amino acid sequence being highly conserved between members and among divergent species. FGFR family members differ from one another in their ligand affinities and tissue distribution. A full-length representative protein would consist of an extracellular region, composed of three immunoglobulin-like domains, a single hydrophobic membrane-spanning segment and a cytoplasmic tyrosine kinase domain. The extracellular portion of the protein interacts with fibroblast growth factors, setting in motion a cascade of downstream signals, ultimately influencing mitogenesis and differentiation. This particular family member binds acidic and basic fibroblast growth hormone and plays a role in bone development and maintenance. Mutations in this gene lead to craniosynostosis and multiple types of skeletal dysplasia. [provided by RefSeq, Aug 2017] | 
| Protein Families | Druggable Genome, Protein Kinase, Transmembrane | 
| Protein Pathways | Bladder cancer, Endocytosis, MAPK signaling pathway, Pathways in cancer, Regulation of actin cytoskeleton | 
Documents
| FAQs | 
| SDS | 
Resources
| 蛋白相关资源 | 
Other Versions
| SKU | Description | Size | Price | 
|---|---|---|---|
| LC424902 | FGFR3 HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 1470.00  | 
                                            |
| LY424902 | Transient overexpression lysate of fibroblast growth factor receptor 3 (FGFR3), transcript variant 1 | 
                                                     CNY 4840.00  | 
                                            |
| TP315533 | Recombinant protein of human fibroblast growth factor receptor 3 (FGFR3), transcript variant 1, 20 µg | 
                                                     
                                                        
                                                        
                                                        
                                                            CNY 2900.00  | 
                                            |
| TP700122 | Purified recombinant protein of human fibroblast growth factor receptor 3 (achondroplasia, thanatophoric dwarfism)(FGFR3), transcript variant 1, with C-terminal DDK/His tag, expressed in human cells, 20 µg | 
                                                     CNY 6650.00  | 
                                            |
| TP700123 | Purified recombinant protein FGFR3 (DDK-His-tagged)-Extra Cellular Domain Clone of Homo sapiens fibroblast growth factor receptor 3, transcript variant 2, Signal peptide (1-22) plus EC domain (23-310) expressed in human cells, 20 µg | 
                                                     CNY 6650.00  | 
                                            |
| TP700124 | Purified recombinant protein of human fibroblast growth factor receptor 3 (achondroplasia, thanatophoric dwarfism)(FGFR3), transcript variant 3, with C-terminal DDK/His tag, expressed in human cells, 20 µg | 
                                                     CNY 6650.00  | 
                                            |
| TP710033 | Recombinant protein of human fibroblast growth factor receptor 3 (FGFR3), residues 23-375, with C-terminal DDK tag, expressed in sf9 cells. | 
                                                     CNY 4020.00  | 
                                            
