C3orf37 (HMCES) (NM_020187) Human Mass Spec Standard
CAT＃: PH315567
C3orf37 MS Standard C13 and N15-labeled recombinant protein (NP_064572)
View other "C3orf37" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 14250.00
Product images
Specifications
| Product Data | |
| Description | C3orf37 MS Standard C13 and N15-labeled recombinant protein (NP_064572) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC215567 |
| Predicted MW | 40.6 kDa |
| Protein Sequence |
>RC215567 protein sequence
Red=Cloning site Green=Tags(s) MCGRTSCHLPRDVLTRACAYQDRRGQQRLPEWRDPDKYCPSYNKSPQSNSPVLLSRLHFEKDADSSERII APMRWGLVPSWFKESDPSKLQFNTTNCRSDTVMEKRSFKVPLGKGRRCVVLADGFYEWQRCQGTNQRQPY FIYFPQIKTEKSGSIGAADSPENWEKVWDNWRLLTMAGIFDCWEPPEGGDVLYSYTIITVDSCKGLSDIH HRMPAILDGEEAVSKWLDFGEVSTQEALKLIHPTENITFHAVSSVVNNSRNNTPECLAPVDLVVKKELRA SGSSQRMLQWLATKSPKKEDSKTPQKEESDVPQWSSQFLQKSPLPTKRGTAGLLEQWLKREKEEEPVAKR PYSQ myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_064572 |
| RefSeq Size | 1638 |
| RefSeq ORF | 1062 |
| Synonyms | C3orf37; DC12; SRAPD1 |
| Locus ID | 56941 |
| Cytogenetics | 3q21.3 |
| Summary | Sensor of abasic sites in single-stranded DNA (ssDNA) required to preserve genome integrity by promoting error-free repair of abasic sites (PubMed:30554877). Acts as an enzyme that recognizes and binds abasic sites in ssDNA at replication forks and chemically modifies the lesion by forming a covalent cross-link with DNA (PubMed:30554877). The HMCES DNA-protein cross-link is then degraded by the proteasome (PubMed:30554877). Promotes error-free repair of abasic sites by acting as a 'suicide' enzyme that is degraded, thereby protecting abasic sites from translesion synthesis (TLS) polymerases and endonucleases that are error-prone and would generate mutations and double-strand breaks (PubMed:30554877). Acts as a protease: mediates autocatalytic processing of its N-terminal methionine in order to expose the catalytic cysteine (By similarity). Specifically binds 5-hydroxymethylcytosine (5hmC)-containing DNA in stem cells (By similarity). May act as an endonuclease that specifically cleaves 5hmC-containing DNA; additional experiments are however required to confirm this activity in vivo (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC412609 | HMCES HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC423676 | HMCES HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY412609 | Transient overexpression lysate of chromosome 3 open reading frame 37 (C3orf37), transcript variant 2 |
CNY 3080.00 |
|
| LY423676 | Transient overexpression lysate of chromosome 3 open reading frame 37 (C3orf37), transcript variant 1 |
CNY 3080.00 |
|
| PH308710 | C3orf37 MS Standard C13 and N15-labeled recombinant protein (NP_001006109) |
CNY 19520.00 |
|
| TP308710 | Recombinant protein of human chromosome 3 open reading frame 37 (C3orf37), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP315567 | Recombinant protein of human chromosome 3 open reading frame 37 (C3orf37), transcript variant 2, 20 µg |
CNY 2900.00 |
其它C3orf37产品
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
