IFI27L1 (NM_145249) Human Mass Spec Standard
CAT#: PH315576
IFI27L1 MS Standard C13 and N15-labeled recombinant protein (NP_660292)
View other "IFI27L1" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
Specifications
| Product Data | |
| Description | IFI27L1 MS Standard C13 and N15-labeled recombinant protein (NP_660292) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC215576 |
| Predicted MW | 9.5 kDa |
| Protein Sequence |
>RC215576 protein sequence
Red=Cloning site Green=Tags(s) MGKESGWDSGRAAVAAVVGGVVAVGTVLVALSAMGFTSVGIAASSIAAKMMSTAAIANGGGVAAGSLVAI LQSVGAAGLSVTSKVIGGFAGTALGAWLGSPPSS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_660292 |
| RefSeq Size | 732 |
| RefSeq ORF | 312 |
| Synonyms | FAM14B; ISG12C |
| Locus ID | 122509 |
| Cytogenetics | 14q32.12 |
| Summary | Plays a role in the apoptotic process and has a pro-apoptotic activity.[UniProtKB/Swiss-Prot Function] |
| Protein Families | Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC404190 | IFI27L1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC407983 | IFI27L1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY404190 | Transient overexpression lysate of interferon, alpha-inducible protein 27-like 1 (IFI27L1), transcript variant 2 |
CNY 3080.00 |
|
| LY407983 | Transient overexpression lysate of interferon, alpha-inducible protein 27-like 1 (IFI27L1), transcript variant 1 |
CNY 3080.00 |
|
| TP315576 | Recombinant protein of human interferon, alpha-inducible protein 27-like 1 (IFI27L1), transcript variant 1, 20 µg |
CNY 2900.00 |
其它IFI27L1产品
