Ecat1 (KHDC3L) (NM_001017361) Human Mass Spec Standard
CAT#: PH315631
C6orf221 MS Standard C13 and N15-labeled recombinant protein (NP_001017361)
View other "Ecat1" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
Specifications
Product Data | |
Description | C6orf221 MS Standard C13 and N15-labeled recombinant protein (NP_001017361) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC215631 |
Predicted MW | 24.1 kDa |
Protein Sequence |
>RC215631 representing NM_001017361
Red=Cloning site Green=Tags(s) MDAPRRFPTLVQLMQPKAMPVEVLGHLPKRFSWFHSEFLKNPKVVRLEVWLVEKIFGRGGERIPHVQGMS QILIHVNRLDPNGEAEILVFGRPSYQEDTIKMIMNLADYHRQLQAKGSGKALAQDVATQKAETQRSSIEV REAGTQRSVEVREAGTQRSVEVQEVGTQGSPVEVQEAGTQQSLQAANKSGTQRSPEAASKAVTQRFREDA RDPVTRL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001017361 |
RefSeq Size | 1063 |
RefSeq ORF | 651 |
Synonyms | C6orf221; ECAT1; HYDM2 |
Locus ID | 154288 |
Cytogenetics | 6q13 |
Summary | The protein encoded by this gene belongs to the KHDC1 family, members of which contain an atypical KH domain that may not bind RNA like canonical KH domains. This gene is specifically expressed in the oocytes, and recent studies suggest that it may function as a regulator of genomic imprinting in the oocyte. Mutations in this gene are associated with recurrent biparental complete hydatidiform mole. [provided by RefSeq, Dec 2011] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400398 | KHDC3L HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400398 | Transient overexpression lysate of chromosome 6 open reading frame 221 (C6orf221) |
CNY 3080.00 |
|
TP315631 | Recombinant protein of human chromosome 6 open reading frame 221 (C6orf221), 20 µg |
CNY 2900.00 |