NAT8B (NM_016347) Human Mass Spec Standard
CAT#: PH315647
NAT8B MS Standard C13 and N15-labeled recombinant protein (NP_057431)
View other "NAT8B" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | NAT8B MS Standard C13 and N15-labeled recombinant protein (NP_057431) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC215647 |
Predicted MW | 25.4 kDa |
Protein Sequence |
>RC215647 representing NM_016347
Red=Cloning site Green=Tags(s) MAPYHIRKYQESDRKSVVGLLSGGMAEHAPATFRRLLKLPRTLILLLGGALALLLVSGSWILALVFSLSL LPALWFLAKKPWTRYVDIALRTDMSDITKSYLSECGSCFWVAESEEKVVGTVGALPVDDPTLREKRLQLF HLSVDNEHRGQGIAKALVRTVLQFARDQGYSEVVLDTSNIQLSAMGLYQSLGFKKTGQSFFHVWARLVDL HTVHFIYHLPSAQAGRL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_057431 |
RefSeq Size | 845 |
RefSeq ORF | 681 |
Synonyms | CML2; Hcml2; NAT8BP |
Locus ID | 51471 |
Cytogenetics | 2p13.1 |
Summary | The protein encoded by this gene is highly similar to the N-acetyltransferase 8 (NAT8) gene product, which is a kidney and liver protein with homology to bacterial acetyltransferases involved in drug resistance. This gene is localized on chromosome 2 in the vicinity of the NAT8 gene and may represent a pseudogene of NAT8. This gene contains two polymorphic nonsense mutations that disrupt the active site of the protein. The full-length product of this gene contains a complete acetyltransferase domain and is identical in length to NAT8. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402542 | NAT8B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402542 | Transient overexpression lysate of N-acetyltransferase 8B (GCN5-related, putative, gene/pseudogene) (NAT8B) |
CNY 3080.00 |
|
TP315647 | Recombinant protein of human N-acetyltransferase 8B (GCN5-related, putative, gene/pseudogene) (NAT8B), 20 µg |
CNY 2900.00 |