OSBPL2 (NM_014835) Human Mass Spec Standard
CAT＃: PH315660
OSBPL2 MS Standard C13 and N15-labeled recombinant protein (NP_055650)
View other "OSBPL2" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Product images
CNY 1999.00
CNY 2700.00
CNY 3080.00
Specifications
| Product Data | |
| Description | OSBPL2 MS Standard C13 and N15-labeled recombinant protein (NP_055650) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC215660 |
| Predicted MW | 53.8 kDa |
| Protein Sequence |
>RC215660 representing NM_014835
Red=Cloning site Green=Tags(s) MNGEEEFFDAVTEANQKVTGMIDLDTSKNNRIGKTGERPSQENGIQKHRTSLPAPMFSRSDFSVWTILKK CVGLELSKITMPIAFNEPLSFLQRITEYMEHVYLIHRASCQPQPLERMQSVAAFAVSAVASQWERTGKPF NPLLGETYELIREDLGFRFISEQVSHHPPISAFHSEGLNHDFLFHGSIYPKLKFWGKSVEAEPRGTITLE LLKHNEAYTWTNPTCCVHNVIIGKLWIEQYGTVEILNHRTGHKCVLHFKPCGLFGKELHKVEGHIQDKNK KKLFMIYGKWTECLWGIDPVSYESFKKQERRGDHLRKAKLDEDSGKADSDVADDVPVAQETVQVIPGSKL LWRINTRPPNSAQMYNFTSFTVSLNELETGMEKTLPPTDCRLRPDIRGMENGNMDLASQEKERLEEKQRE ARRERAKEEAEWQTRWFYPGNNPYTGTPDWLYAGDYFERNFSDCPDIY myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_055650 |
| RefSeq Size | 3935 |
| RefSeq ORF | 1404 |
| Synonyms | DFNA67; DNFA67; ORP-2; ORP2 |
| Locus ID | 9885 |
| Cytogenetics | 20q13.33 |
| Summary | This gene encodes a member of the oxysterol-binding protein (OSBP) family, a group of intracellular lipid receptors. Most members contain an N-terminal pleckstrin homology domain and a highly conserved C-terminal OSBP-like sterol-binding domain, although the encoded protein contains only the sterol-binding domain. In vitro studies have shown that the encoded protein can bind strongly to phosphatic acid and weakly to phosphatidylinositol 3-phosphate, but cannot bind to 25-hydroxycholesterol. The protein associates with the Golgi apparatus. Transcript variants encoding different isoforms have been described. [provided by RefSeq, Sep 2014] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC408266 | OSBPL2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC414990 | OSBPL2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY408266 | Transient overexpression lysate of oxysterol binding protein-like 2 (OSBPL2), transcript variant 2 |
CNY 3080.00 |
|
| LY414990 | Transient overexpression lysate of oxysterol binding protein-like 2 (OSBPL2), transcript variant 1 |
CNY 4840.00 |
|
| PH301344 | OSBPL2 MS Standard C13 and N15-labeled recombinant protein (NP_653081) |
CNY 19520.00 |
|
| TP301344 | Recombinant protein of human oxysterol binding protein-like 2 (OSBPL2), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP315660 | Recombinant protein of human oxysterol binding protein-like 2 (OSBPL2), transcript variant 1, 20 µg |
CNY 2900.00 |
