SPRR2F (NM_001014450) Human Mass Spec Standard
CAT#: PH316115
SPRR2F MS Standard C13 and N15-labeled recombinant protein (NP_001014450)
View other "SPRR2F" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 14250.00
Specifications
| Product Data | |
| Description | SPRR2F MS Standard C13 and N15-labeled recombinant protein (NP_001014450) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC216115 |
| Predicted MW | 7.6 kDa |
| Protein Sequence |
>RC216115 representing NM_001014450
Red=Cloning site Green=Tags(s) MSYQQQQCKQPCQPPPVCPAPKCPEPCPPPKCPEPCPPSKCPQSCPPQQCQQKCPPVTPSPPCQPKCPPK SK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001014450 |
| RefSeq Size | 657 |
| RefSeq ORF | 216 |
| Locus ID | 6705 |
| Cytogenetics | 1q21.3 |
| Summary | Cross-linked envelope protein of keratinocytes. It is a keratinocyte protein that first appears in the cell cytosol, but ultimately becomes cross-linked to membrane proteins by transglutaminase. All that results in the formation of an insoluble envelope beneath the plasma membrane (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC423073 | SPRR2F HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY423073 | Transient overexpression lysate of small proline-rich protein 2F (SPRR2F) |
CNY 3080.00 |
|
| TP316115 | Recombinant protein of human small proline-rich protein 2F (SPRR2F), 20 µg |
CNY 2900.00 |

