P2X2 (P2RX2) (NM_170682) Human Mass Spec Standard
CAT＃: PH316207
P2RX2 MS Standard C13 and N15-labeled recombinant protein (NP_733782)
View other "P2X2" proteins (18)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Product images
Specifications
| Product Data | |
| Description | P2RX2 MS Standard C13 and N15-labeled recombinant protein (NP_733782) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC216207 |
| Predicted MW | 51.6 kDa |
| Protein Sequence |
>RC216207 representing NM_170682
Red=Cloning site Green=Tags(s) MAAAQPKYPAGATARRLARGCWSALWDYETPKVIVVRNRRLGVLYRAVQLLILLYFVWYVFIVQKSYQES ETGPESSIITKVKGITTSEHKVWDVEEYVKPPEGGSVFSIITRVEATHSQTQGTCPESIRVHNATCLSDA DCVAGELDMLGNGLRTGRCVPYYQGPSKTCEVFGWCPVEDGASVSQFLGTMAPNFTILIKNSIHYPKFHF SKGNIADRTDGYLKRCTFHEASDLYCPIFKLGFIVEKAGESFTELAHKGGVIGVIINWDCDLDLPASECN PKYSFRRLDPKHVPASSGYNFRFAKYYKINGTTTRTLIKAYGIRIDVIVHGQAGKFSLIPTIINLATALT SVGVGSFLCDWILLTFMNKNKVYSHKKFDKVCTPSHPSGSWPVTLARVLGQAPPEPGHRSEDQHPSPPSG QEGQQGAECGPAFPPLRPCPISAPSEQMVDTPASEPAQASTPTDPKGLAQL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_733782 |
| RefSeq Size | 1830 |
| RefSeq ORF | 1413 |
| Synonyms | DFNA41; P2X2 |
| Locus ID | 22953 |
| Cytogenetics | 12q24.33 |
| Summary | The product of this gene belongs to the family of purinoceptors for ATP. This receptor functions as a ligand-gated ion channel. Binding to ATP mediates synaptic transmission between neurons and from neurons to smooth muscle. Multiple transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Aug 2013] |
| Protein Families | Druggable Genome, Ion Channels: ATP Receptors, Transmembrane |
| Protein Pathways | Calcium signaling pathway, Neuroactive ligand-receptor interaction |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403528 | P2RX2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC406287 | P2RX2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC406792 | P2RX2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC414051 | P2RX2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC415901 | P2RX2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC430303 | P2RX2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC430413 | P2RX2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY403528 | Transient overexpression lysate of purinergic receptor P2X, ligand-gated ion channel, 2 (P2RX2), transcript variant 1 |
CNY 4840.00 |
|
| LY406287 | Transient overexpression lysate of purinergic receptor P2X, ligand-gated ion channel, 2 (P2RX2), transcript variant 5 |
CNY 3080.00 |
|
| LY406792 | Transient overexpression lysate of purinergic receptor P2X, ligand-gated ion channel, 2 (P2RX2), transcript variant 4 |
CNY 4840.00 |
|
| LY414051 | Transient overexpression lysate of purinergic receptor P2X, ligand-gated ion channel, 2 (P2RX2), transcript variant 3 |
CNY 4840.00 |
|
| LY415901 | Transient overexpression lysate of purinergic receptor P2X, ligand-gated ion channel, 2 (P2RX2), transcript variant 6 |
CNY 3080.00 |
|
| LY430303 | Transient overexpression lysate of purinergic receptor P2X, ligand-gated ion channel, 2 (P2RX2), transcript variant 4 |
CNY 3080.00 |
|
| LY430413 | Transient overexpression lysate of purinergic receptor P2X, ligand-gated ion channel, 2 (P2RX2), transcript variant 5 |
CNY 3080.00 |
|
| TP316207 | Recombinant protein of human purinergic receptor P2X, ligand-gated ion channel, 2 (P2RX2), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP700189 | Recombinant protein of human purinergic receptor P2X, ligand-gated ion channel, 2 (P2RX2), V60L mutant of transcript variant 1, 20 ug |
CNY 6650.00 |
|
| TP700190 | Recombinant protein of human purinergic receptor P2X, ligand-gated ion channel, 2 (P2RX2), K81A mutant of transcript variant 1, 20 ug |
CNY 6650.00 |
|
| TP700191 | Recombinant protein of human purinergic receptor P2X, ligand-gated ion channel, 2 (P2RX2), G353R mutant of transcript variant 1, 20 ug |
CNY 6650.00 |
