SPANXN4 (NM_001009613) Human Mass Spec Standard
CAT#: PH316287
SPANXN4 MS Standard C13 and N15-labeled recombinant protein (NP_001009613)
View other "SPANXN4" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | SPANXN4 MS Standard C13 and N15-labeled recombinant protein (NP_001009613) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC216287 |
Predicted MW | 11.2 kDa |
Protein Sequence |
>RC216287 protein sequence
Red=Cloning site Green=Tags(s) MEEPTSSTNENKMKSPCESNKRKVDKKKKNLHRASAPEQSLKETEKAKYPTLVFYCRKNKKRNSNQLENN QPTESSTDPIKEKGDLDISAGSPQDGGQN myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001009613 |
RefSeq Size | 431 |
RefSeq ORF | 297 |
Synonyms | CT11.9 |
Locus ID | 441525 |
Cytogenetics | Xq27.3 |
Summary | This gene represents one of several duplicated family members that are located on the X chromosome. This gene family encodes proteins that play a role in spermiogenesis. These proteins represent a specific subgroup of cancer/testis-associated antigens, and they may be candidates for tumor vaccines. This family member belongs to a subgroup of related genes that are present in all primates and rats and mice, and thus, it represents one of the ancestral family members. [provided by RefSeq, Sep 2009] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC422927 | SPANXN4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY422927 | Transient overexpression lysate of SPANX family, member N4 (SPANXN4) |
CNY 3080.00 |
|
TP316287 | Recombinant protein of human SPANX family, member N4 (SPANXN4), 20 µg |
CNY 2900.00 |
其它SPANXN4产品