RASSF2 (NM_014737) Human Mass Spec Standard
CAT＃: PH316299
RASSF2 MS Standard C13 and N15-labeled recombinant protein (NP_055552)
View other "RASSF2" proteins (8)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Product images
Specifications
| Product Data | |
| Description | RASSF2 MS Standard C13 and N15-labeled recombinant protein (NP_055552) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC216299 |
| Predicted MW | 37.6 kDa |
| Protein Sequence |
>RC216299 representing NM_014737
Red=Cloning site Green=Tags(s) MDYSHQTSLVPCGQDKYISKNELLLHLKTYNLYYEGQNLQLRHREEEDEFIVEGLLNISWGLRRPIRLQM QDDNERIRPPPSSSSWHSGCNLGAQGTTLKPLTVPKVQISEVDAPPEGDQMPSSTDSRGLKPLQEDTPQL MRTRSDVGVRRRGNVRTPSDQRRIRRHRFSINGHFYNHKTSVFTPAYGSVTNVRINSTMTTPQVLKLLLN KFKIENSAEEFALYVVHTSGEKQKLKATDYPLIARILQGPCEQISKVFLMEKDQVEEVTYDVAQYIKFEM PVLKSFIQKLQEEEDREVKKLMRKYTVLRLMIRQRLEEIAETPATI myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_055552 |
| RefSeq Size | 5426 |
| RefSeq ORF | 978 |
| Synonyms | CENP-34; RASFADIN |
| Locus ID | 9770 |
| Cytogenetics | 20p13 |
| Summary | This gene encodes a protein that contains a Ras association domain. Similar to its cattle and sheep counterparts, this gene is located near the prion gene. Two alternatively spliced transcripts encoding the same isoform have been reported. [provided by RefSeq, Jul 2008] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC406875 | RASSF2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC415073 | RASSF2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC429435 | RASSF2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY406875 | Transient overexpression lysate of Ras association (RalGDS/AF-6) domain family member 2 (RASSF2), transcript variant 2 |
CNY 3080.00 |
|
| LY415073 | Transient overexpression lysate of Ras association (RalGDS/AF-6) domain family member 2 (RASSF2), transcript variant 1 |
CNY 3080.00 |
|
| PH317404 | RASSF2 MS Standard C13 and N15-labeled recombinant protein (NP_739580) |
CNY 19520.00 |
|
| TP316299 | Recombinant protein of human Ras association (RalGDS/AF-6) domain family member 2 (RASSF2), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP317404 | Recombinant protein of human Ras association (RalGDS/AF-6) domain family member 2 (RASSF2), transcript variant 2, 20 µg |
CNY 2900.00 |
Recombinant protein of human Ras association (RalGDS/AF-6) domain family member 2 (RASSF2), transcript variant 1, 100 µg
