ATG4B (NM_178326) Human Mass Spec Standard
CAT#: PH316453
ATG4B MS Standard C13 and N15-labeled recombinant protein (NP_847896)
View other "ATG4B" proteins (9)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
CNY 3080.00
Specifications
Product Data | |
Description | ATG4B MS Standard C13 and N15-labeled recombinant protein (NP_847896) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC216453 |
Predicted MW | 42.4 kDa |
Protein Sequence |
>RC216453 representing NM_178326
Red=Cloning site Green=Tags(s) MDAATLTYDTLRFAEFEDFPETSEPVWILGRKYSIFTEKDEILSDVASRLWFTYRKNFPAIGGTGPTSDT GWGCMLRCGQMIFAQALVCRHLGRDWRWTQRKRQPDSYFSVLNAFIDRKDSYYSIHQIAQMGVGEGKSIG QWYGPNTVAQVLKKLAVFDTWSSLAVHIAMDNTVVMEEIRRLCRTSVPCAGATAFPADSDRHCNGFPAGA EVTNRPSPWRPLVLLIPLRLGLTDINEAYVETLKHCFMMPQSLGVIGGKPNSAHYFIGYVGEELIYLDPH TTQPAVEPTDGCFIPDESFHCQHPPCRMSIAELDPSIAVGFFCKTEDDFNDWCQQVKKLSLLGGALPMFE LVELQPSHLACPDVLNLSLGESCQVQILLM myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_847896 |
RefSeq Size | 2912 |
RefSeq ORF | 1140 |
Synonyms | APG4B; AUTL1 |
Locus ID | 23192 |
Cytogenetics | 2q37.3 |
Summary | Autophagy is the process by which endogenous proteins and damaged organelles are destroyed intracellularly. Autophagy is postulated to be essential for cell homeostasis and cell remodeling during differentiation, metamorphosis, non-apoptotic cell death, and aging. Reduced levels of autophagy have been described in some malignant tumors, and a role for autophagy in controlling the unregulated cell growth linked to cancer has been proposed. This gene encodes a member of the autophagin protein family. The encoded protein is also designated as a member of the C-54 family of cysteine proteases. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008] |
Protein Families | Protease |
Protein Pathways | Regulation of autophagy |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403600 | ATG4B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC415627 | ATG4B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC429376 | ATG4B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403600 | Transient overexpression lysate of ATG4 autophagy related 4 homolog B (S. cerevisiae) (ATG4B), transcript variant 2 |
CNY 3080.00 |
|
LY415627 | Transient overexpression lysate of ATG4 autophagy related 4 homolog B (S. cerevisiae) (ATG4B), transcript variant 1 |
CNY 3080.00 |
|
LY429376 | Transient overexpression lysate of ATG4 autophagy related 4 homolog B (S. cerevisiae) (ATG4B), transcript variant 1 |
CNY 3080.00 |
|
PH300289 | ATG4B MS Standard C13 and N15-labeled recombinant protein (NP_037457) |
CNY 19520.00 |
|
TP300289 | Recombinant protein of human ATG4 autophagy related 4 homolog B (S. cerevisiae) (ATG4B), transcript variant 1, 20 µg |
CNY 2900.00 |
|
TP316453 | Recombinant protein of human ATG4 autophagy related 4 homolog B (S. cerevisiae) (ATG4B), transcript variant 2, 20 µg |
CNY 2900.00 |