C4orf33 (NM_001099783) Human Mass Spec Standard
CAT#: PH316543
C4orf33 MS Standard C13 and N15-labeled recombinant protein (NP_001093253)
View other "C4orf33" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | C4orf33 MS Standard C13 and N15-labeled recombinant protein (NP_001093253) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC216543 |
| Predicted MW | 23.3 kDa |
| Protein Sequence |
>RC216543 representing NM_001099783
Red=Cloning site Green=Tags(s) MDFKIEHTWDGFPVKHEPVFIRLNPGDRGVMMDISAPFFRDPPAPLGEPGKPFNELWDYEVVEAFFLNDI TEQYLEVELCPHGQHLVLLLSGRRNVWKQELPLSFRMSRGETKWEGKAYLPWSYFPPNVTKFNSFAIHGS KDKRSYEALYPVPQHELQQGQKPDFHCLEYFKSFNFNTLLGEEWKQPESDLWLIEKCDI myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001093253 |
| RefSeq Size | 1601 |
| RefSeq ORF | 597 |
| Locus ID | 132321 |
| Cytogenetics | 4q28.2 |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC406603 | C4orf33 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC420533 | C4orf33 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY406603 | Transient overexpression lysate of chromosome 4 open reading frame 33 (C4orf33), transcript variant 1 |
CNY 3080.00 |
|
| LY420533 | Transient overexpression lysate of chromosome 4 open reading frame 33 (C4orf33), transcript variant 2 |
CNY 3080.00 |
|
| PH307633 | C4orf33 MS Standard C13 and N15-labeled recombinant protein (NP_775758) |
CNY 19520.00 |
|
| TP307633 | Recombinant protein of human chromosome 4 open reading frame 33 (C4orf33), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP316543 | Recombinant protein of human chromosome 4 open reading frame 33 (C4orf33), transcript variant 2, 20 µg |
CNY 2900.00 |
其它C4orf33产品
