TNNT3 (NM_006757) Human Mass Spec Standard
CAT#: PH316642
TNNT3 MS Standard C13 and N15-labeled recombinant protein (NP_006748)
View other "TNNT3" proteins (13)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | TNNT3 MS Standard C13 and N15-labeled recombinant protein (NP_006748) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC216642 |
| Predicted MW | 31 kDa |
| Protein Sequence |
>RC216642 representing NM_006757
Red=Cloning site Green=Tags(s) MSDEEVEQVEEQYEEEEEAQEEEEVQEDTAEEDAEEEKPRPKLTAPKIPEGEKVDFDDIQKKRQNKDLME LQALIDSHFEARKKEEEELVALKERIEKRRAERAEQQRIRAEKERERQNRLAEEKARREEEDAKRRAEDD LKKKKALSSMGANYSSYLAKADQKRGKKQTAREMKKKILAERRKPLNIDHLGEDKLRDKAKELWETLHQL EIDKFEFGEKLKRQKYDITTLRSRIDQAQKHSKKAGTPAKGKVGGRWK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_006748 |
| RefSeq Size | 1217 |
| RefSeq ORF | 774 |
| Synonyms | beta-TnTF; DA2B2; TNTF |
| Locus ID | 7140 |
| Cytogenetics | 11p15.5 |
| Summary | The binding of Ca(2+) to the trimeric troponin complex initiates the process of muscle contraction. Increased Ca(2+) concentrations produce a conformational change in the troponin complex that is transmitted to tropomyosin dimers situated along actin filaments. The altered conformation permits increased interaction between a myosin head and an actin filament which, ultimately, produces a muscle contraction. The troponin complex has protein subunits C, I, and T. Subunit C binds Ca(2+) and subunit I binds to actin and inhibits actin-myosin interaction. Subunit T binds the troponin complex to the tropomyosin complex and is also required for Ca(2+)-mediated activation of actomyosin ATPase activity. There are 3 different troponin T genes that encode tissue-specific isoforms of subunit T for fast skeletal-, slow skeletal-, and cardiac-muscle. This gene encodes fast skeletal troponin T protein; also known as troponin T type 3. Alternative splicing results in multiple transcript variants encoding additional distinct troponin T type 3 isoforms. A developmentally regulated switch between fetal/neonatal and adult troponin T type 3 isoforms occurs. Additional splice variants have been described but their biological validity has not been established. Mutations in this gene may cause distal arthrogryposis multiplex congenita type 2B (DA2B). [provided by RefSeq, Oct 2009] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402019 | TNNT3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC420809 | TNNT3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC420811 | TNNT3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC425799 | TNNT3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402019 | Transient overexpression lysate of troponin T type 3 (skeletal, fast) (TNNT3), transcript variant 1 |
CNY 3080.00 |
|
| LY420809 | Transient overexpression lysate of troponin T type 3 (skeletal, fast) (TNNT3), transcript variant 3 |
CNY 3080.00 |
|
| LY420811 | Transient overexpression lysate of troponin T type 3 (skeletal, fast) (TNNT3), transcript variant 4 |
CNY 3080.00 |
|
| LY425799 | Transient overexpression lysate of troponin T type 3 (skeletal, fast) (TNNT3), transcript variant 3 |
CNY 3080.00 |
|
| PH312563 | TNNT3 MS Standard C13 and N15-labeled recombinant protein (NP_001036245) |
CNY 19520.00 |
|
| PH323893 | TNNT3 MS Standard C13 and N15-labeled recombinant protein (NP_001036247) |
CNY 19520.00 |
|
| TP312563 | Recombinant protein of human troponin T type 3 (skeletal, fast) (TNNT3), transcript variant 3, 20 µg |
CNY 2900.00 |
|
| TP316642 | Recombinant protein of human troponin T type 3 (skeletal, fast) (TNNT3), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP323893 | Recombinant protein of human troponin T type 3 (skeletal, fast) (TNNT3), transcript variant 4, 20 µg |
CNY 2900.00 |
