UBE1C (UBA3) (NM_198195) Human Mass Spec Standard
CAT#: PH316801
UBA3 MS Standard C13 and N15-labeled recombinant protein (NP_937838)
View other "UBE1C" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 4840.00
Specifications
| Product Data | |
| Description | UBA3 MS Standard C13 and N15-labeled recombinant protein (NP_937838) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC216801 |
| Predicted MW | 49.9 kDa |
| Protein Sequence |
>RC216801 representing NM_198195
Red=Cloning site Green=Tags(s) MADGEEPMAVDGGCGDTGDWEGRWNHVKKFLERSGPFTHPDFEPSTESLQFLLDTCKVLVIGAGGLGCEL LKNLALSGFRQIHVIDMDTIDVSNLNRQFLFRPKDIGRPKAEVAAEFLNDRVPNCNVVPHFNKIQDFNDT FYRQFHIIVCGLDSIIARRWINGMLISLLNYEDGVLDPSSIVPLIDGGTEGFKGNARVILPGMTACIECT LELYPPQVNFPMCTIASMPRLPEHCIEYVRMLQWPKEQPFGEGVPLDGDDPEHIQWIFQKSLERASQYNI RGVTYRLTQGVVKRIIPAVASTNAVIAAVCATEVFKIATSAYIPLNNYLVFNDVDGLYTYTFEAERKENC PACSQLPQNIQFSPSAKLQEVLDYLTNSASLQMKSPAITATLEGKNRTLYLQSVTSIEERTRPNLSKTLK ELGLVDGQELAVADVTTPQTVLFKLHFTS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_937838 |
| RefSeq Size | 2094 |
| RefSeq ORF | 1347 |
| Synonyms | hUBA3; NAE2; UBE1C |
| Locus ID | 9039 |
| Cytogenetics | 3p14.1 |
| Summary | The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E1 ubiquitin-activating enzyme family. The encoded enzyme associates with AppBp1, an amyloid beta precursor protein binding protein, to form a heterodimer, and then the enzyme complex activates NEDD8, a ubiquitin-like protein, which regulates cell division, signaling and embryogenesis. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
| Protein Pathways | Ubiquitin mediated proteolysis |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC404973 | UBA3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC418315 | UBA3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY404973 | Transient overexpression lysate of ubiquitin-like modifier activating enzyme 3 (UBA3), transcript variant 2 |
CNY 4840.00 |
|
| LY418315 | Transient overexpression lysate of ubiquitin-like modifier activating enzyme 3 (UBA3), transcript variant 1 |
CNY 3080.00 |
|
| PH304675 | UBA3 MS Standard C13 and N15-labeled recombinant protein (NP_003959) |
CNY 19520.00 |
|
| TP304675 | Recombinant protein of human ubiquitin-like modifier activating enzyme 3 (UBA3), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP316801 | Recombinant protein of human ubiquitin-like modifier activating enzyme 3 (UBA3), transcript variant 2, 20 µg |
CNY 2900.00 |
