Annexin VI (ANXA6) (NM_004033) Human Mass Spec Standard
CAT#: PH316809
ANXA6 MS Standard C13 and N15-labeled recombinant protein (NP_004024)
View other "Annexin VI" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | ANXA6 MS Standard C13 and N15-labeled recombinant protein (NP_004024) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC216809 |
Predicted MW | 75.1 kDa |
Protein Sequence |
>RC216809 representing NM_004033
Red=Cloning site Green=Tags(s) MAKPAQGAKYRGSIHDFPGFDPNQDAEALYTAMKGFGSDKEAILDIITSRSNRQRQEVCQSYKSLYGKDL IADLKYELTGKFERLIVGLMRPPAYCDAKEIKDAISGIGTDEKCLIEILASRTNEQMHQLVAAYKDAYER DLEADIIGDTSGHFQKMLVVLLQGTREEDDVVSEDLVQQDVQDLYEAGELKWGTDEAQFIYILGNRSKQH LRLVFDEYLKTTGKPIEASIRGELSGDFEKLMLAVVKCIRSTPEYFAERLFKAMKGLGTRDNTLIRIMVS RSELDMLDIREIFRTKYEKSLYSMIKNDTSGEYKKTLLKLSGGDDDAAGQFFPEAAQVAYQMWELSAVAR VELKGTVRPANDFNPDADAKALRKAMKGLGTDEDTIIDIITHRSNVQRQQIRQTFKSHFGRDLMTDLKSE ISGDLARLILGLMMPPAHYDAKQLKKAMEGAGTDEKALIEILATRTNAEIRAINEAYKEDYHKSLEDALS SDTSGHFRRILISLATGHREEGGENLDQAREDAQEIADTPSGDKTSLETRFMTILCTRSYPHLRRVFQEF IKMTNYDVEHTIKKEMSGDVRDAFVAIVQSVKNKPLFFADKLYKSMKGAGTDEKTLTRIMVSRSEIDLLN IRREFIEKYDKSLHQAIEGDTSGDFLKALLALCGGED myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_004024 |
RefSeq Size | 2897 |
RefSeq ORF | 2001 |
Synonyms | annexin A6; annexin VI; annexin VI (p68); ANX6; calcium-binding protein p68; calelectrin; calphobindin II; CBP68 |
Locus ID | 309 |
Cytogenetics | 5q33.1 |
Summary | Annexin VI belongs to a family of calcium-dependent membrane and phospholipid binding proteins. Several members of the annexin family have been implicated in membrane-related events along exocytotic and endocytotic pathways. The annexin VI gene is approximately 60 kbp long and contains 26 exons. It encodes a protein of about 68 kDa that consists of eight 68-amino acid repeats separated by linking sequences of variable lengths. It is highly similar to human annexins I and II sequences, each of which contain four such repeats. Annexin VI has been implicated in mediating the endosome aggregation and vesicle fusion in secreting epithelia during exocytosis. Alternatively spliced transcript variants have been described. [provided by RefSeq, Aug 2010] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400463 | ANXA6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC418290 | ANXA6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY400463 | Transient overexpression lysate of annexin A6 (ANXA6), transcript variant 1 |
CNY 3,080.00 |
|
LY418290 | Transient overexpression lysate of annexin A6 (ANXA6), transcript variant 2 |
CNY 4,840.00 |
|
TP316809 | Recombinant protein of human annexin A6 (ANXA6), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP720183 | Recombinant protein of human annexin A6 (ANXA6), transcript variant 1 |
CNY 4,060.00 |
|
TP761425 | Purified recombinant protein of Human annexin A6 (ANXA6), transcript variant 1, full length, with N-terminal GST and C-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2,040.00 |
其它Annexin VI产品