TSH beta (TSHB) (NM_000549) Human Mass Spec Standard
CAT#: PH316914
TSHB MS Standard C13 and N15-labeled recombinant protein (NP_000540)
View other "TSH beta" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 14250.00
Specifications
| Product Data | |
| Description | TSHB MS Standard C13 and N15-labeled recombinant protein (NP_000540) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC216914 |
| Predicted MW | 15.61 kDa |
| Protein Sequence |
>RC216914 representing NM_000549
Red=Cloning site Green=Tags(s) MTALFLMSMLFGLACGQAMSFCIPTEYTMHIERRECAYCLTINTTICAGYCMTRDINGKLFLPKYALSQD VCTYRDFIYRTVEIPGCPLHVAPYFSYPVALSCKCGKCNTDYSDCIHEAIKTNYCTKPQKSYLVGFSV myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_000540 |
| RefSeq Size | 578 |
| RefSeq ORF | 414 |
| Synonyms | TSH-B; TSH-BETA |
| Locus ID | 7252 |
| Cytogenetics | 1p13.2 |
| Summary | The four human glycoprotein hormones chorionic gonadotropin (CG), luteinizing hormone (LH), follicle stimulating hormone (FSH), and thyroid stimulating hormone (TSH) are dimers consisting of alpha and beta subunits that are associated noncovalently. The alpha subunits of these hormones are identical, however, their beta chains are unique and confer biological specificity. Thyroid stimulating hormone functions in the control of thyroid structure and metabolism. The protein encoded by this gene is the beta subunit of thyroid stimulating hormone. Mutations in this gene are associated with congenital central and secondary hypothyroidism and Hashimoto's thyroiditis. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, May 2013] |
| Protein Families | Druggable Genome, Secreted Protein |
| Protein Pathways | Autoimmune thyroid disease, Neuroactive ligand-receptor interaction |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC424650 | TSHB HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY424650 | Transient overexpression lysate of thyroid stimulating hormone, beta (TSHB) |
CNY 3080.00 |
|
| TP316914 | Purified recombinant protein of Homo sapiens thyroid stimulating hormone, beta (TSHB), 20 µg |
CNY 2900.00 |
其它TSH beta产品
