M-CSF (CSF1) (NM_000757) Human Mass Spec Standard
CAT＃: PH317104
CSF1 MS Standard C13 and N15-labeled recombinant protein (NP_000748)
View other "M-CSF" proteins (19)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Product images
CNY 1999.00
CNY 2700.00
CNY 4840.00
Specifications
| Product Data | |
| Description | CSF1 MS Standard C13 and N15-labeled recombinant protein (NP_000748) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC217104 |
| Predicted MW | 60.1 kDa |
| Protein Sequence |
>RC217104 protein sequence
Red=Cloning site Green=Tags(s) MTAPGAAGRCPPTTWLGSLLLLVCLLASRSITEEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFV DQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYE TPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQDVVTKPDCNCLYPKAIPSSDPASVSPHQP LAPSMAPVAGLTWEDSEGTEGSSLLPGEQPLHTVDPGSAKQRPPRSTCQSFEPPETPVVKDSTIGGSPQP RPSVGAFNPGMEDILDSAMGTNWVPEEASGEASEIPVPQGTELSPSRPGGGSMQTEPARPSNFLSASSPL PASAKGQQPADVTGTALPRVGPVRPTGQDWNHTPQKTDHPSALLRDPPEPGSPRISSLRPQGLSNPSTLS AQPQLSRSHSSGSVLPLGELEGRRSTRDRRSPAEPEGGPASEGAARPLPRFNSVPLTDTGHERQSEGSSS PQLQESVFHLLVPSVILVLLAVGGLLFYRWRRRSHQEPQRADSPLEQPEGSPLTQDDRQVELPV myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_000748 |
| RefSeq Size | 4249 |
| RefSeq ORF | 1662 |
| Synonyms | CSF-1; MCSF |
| Locus ID | 1435 |
| Cytogenetics | 1p13.3 |
| Summary | The protein encoded by this gene is a cytokine that controls the production, differentiation, and function of macrophages. The active form of the protein is found extracellularly as a disulfide-linked homodimer, and is thought to be produced by proteolytic cleavage of membrane-bound precursors. The encoded protein may be involved in development of the placenta. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Sep 2011] |
| Protein Families | Druggable Genome, ES Cell Differentiation/IPS, Secreted Protein, Transmembrane |
| Protein Pathways | Cytokine-cytokine receptor interaction, Hematopoietic cell lineage |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403534 | CSF1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC406741 | CSF1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC406742 | CSF1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC424534 | CSF1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC430359 | CSF1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY403534 | Transient overexpression lysate of colony stimulating factor 1 (macrophage) (CSF1), transcript variant 2 |
CNY 4840.00 |
|
| LY406741 | Transient overexpression lysate of colony stimulating factor 1 (macrophage) (CSF1), transcript variant 3 |
CNY 3080.00 |
|
| LY406742 | Transient overexpression lysate of colony stimulating factor 1 (macrophage) (CSF1), transcript variant 4 |
CNY 3080.00 |
|
| LY424534 | Transient overexpression lysate of colony stimulating factor 1 (macrophage) (CSF1), transcript variant 1 |
CNY 3080.00 |
|
| LY430359 | Transient overexpression lysate of colony stimulating factor 1 (macrophage) (CSF1), transcript variant 4 |
CNY 3080.00 |
|
| PH305855 | CSF1 MS Standard C13 and N15-labeled recombinant protein (NP_757351) |
CNY 19520.00 |
|
| PH313103 | CSF1 MS Standard C13 and N15-labeled recombinant protein (NP_757349) |
CNY 19520.00 |
|
| PH317172 | CSF1 MS Standard C13 and N15-labeled recombinant protein (NP_757350) |
CNY 19520.00 |
|
| TP305855 | Recombinant protein of human colony stimulating factor 1 (macrophage) (CSF1), transcript variant 4, 20 µg |
CNY 2900.00 |
|
| TP313103 | Recombinant protein of human colony stimulating factor 1 (macrophage) (CSF1), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP317104 | Recombinant protein of human colony stimulating factor 1 (macrophage) (CSF1), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP317172 | Recombinant protein of human colony stimulating factor 1 (macrophage) (CSF1), transcript variant 3, 20 µg |
CNY 2900.00 |
|
| TP720352 | Recombinant protein of human colony stimulating factor 1 (macrophage) (CSF1), transcript variant 1 |
CNY 1800.00 |
|
| TP723739 | Purified recombinant protein of Human colony stimulating factor 1 (macrophage) (CSF1), transcript variant 4 |
CNY 3560.00 |
