POFUT1 (NM_015352) Human Mass Spec Standard
CAT#: PH317185
POFUT1 MS Standard C13 and N15-labeled recombinant protein (NP_056167)
View other "POFUT1" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | POFUT1 MS Standard C13 and N15-labeled recombinant protein (NP_056167) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC217185 |
| Predicted MW | 43.96 kDa |
| Protein Sequence |
>RC217185 representing NM_015352
Red=Cloning site Green=Tags(s) MGAAAWARPLSVSFLLLLLPLPGMPAGSWDPAGYLLYCPCMGRFGNQADHFLGSLAFAKLLNRTLAVPPW IEYQHHKPPFTNLHVSYQKYFKLEPLQAYHRVISLEDFMEKLAPTHWPPEKRVAYCFEVAAQRSPDKKTC PMKEGNPFGPFWDQFHVSFNKSELFTGISFSASYREQWSQRFSPKEHPVLALPGAPAQFPVLEEHRPLQK YMVWSDEMVKTGEAQIHAHLVRPYVGIHLRIGSDWKNACAMLKDGTAGSHFMASPQCVGYSRSTAAPLTM TMCLPDLKEIQRAVKLWVRSLDAQSVYVATDSESYVPELQQLFKGKVKVVSLKPEVAQVDLYILGQADHF IGNCVSSFTAFVKRERDLQGRPSSFFGMDRPPKLRDEF myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_056167 |
| RefSeq Size | 5249 |
| RefSeq ORF | 1164 |
| Synonyms | DDD2; FUT12; O-Fuc-T; O-FucT-1; O-FUT; OFUCT1 |
| Locus ID | 23509 |
| Cytogenetics | 20q11.21 |
| Summary | This gene encodes a member of the glycosyltransferase O-Fuc family. This enzyme adds O-fucose through an O-glycosidic linkage to conserved serine or threonine residues in the epidermal growth factor-like repeats of a number of cell surface and secreted proteins. O-fucose glycans are involved in ligand-induced receptor signaling. Alternative splicing of this gene results in two transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Transcription Factors |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC406756 | POFUT1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC414612 | POFUT1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY406756 | Transient overexpression lysate of protein O-fucosyltransferase 1 (POFUT1), transcript variant 2 |
CNY 3080.00 |
|
| LY414612 | Transient overexpression lysate of protein O-fucosyltransferase 1 (POFUT1), transcript variant 1 |
CNY 3080.00 |
|
| TP317185 | Recombinant protein of human protein O-fucosyltransferase 1 (POFUT1), transcript variant 1, 20 µg |
CNY 2900.00 |
