G CSF (CSF3) (NM_000759) Human Mass Spec Standard
CAT＃: PH317237
CSF3 MS Standard C13 and N15-labeled recombinant protein (NP_000750)
View other "G CSF" proteins (12)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Product images
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | CSF3 MS Standard C13 and N15-labeled recombinant protein (NP_000750) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC217237 |
| Predicted MW | 22.29 kDa |
| Protein Sequence |
>RC217237 representing NM_000759
Red=Cloning site Green=Tags(s) MAGPATQSPMKLMALQLLLWHSALWTVQEATPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLVSECA TYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQ LDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_000750 |
| RefSeq Size | 1518 |
| RefSeq ORF | 621 |
| Synonyms | C17orf33; CSF3OS; GCSF |
| Locus ID | 1440 |
| Cytogenetics | 17q21.1 |
| Summary | This gene encodes a member of the IL-6 superfamily of cytokines. The encoded cytokine controls the production, differentiation, and function of granulocytes. Granulocytes are a type of white blood cell that are part of the innate immune response. A modified form of this protein is commonly administered to manage chemotherapy-induced neutropenia. Alternatively spliced transcript variants have been described for this gene. [provided by RefSeq, May 2020] |
| Protein Families | Druggable Genome, ES Cell Differentiation/IPS, Secreted Protein |
| Protein Pathways | Cytokine-cytokine receptor interaction, Hematopoietic cell lineage, Jak-STAT signaling pathway |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400258 | CSF3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC403533 | CSF3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC432626 | CSF3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400258 | Transient overexpression lysate of colony stimulating factor 3 (granulocyte) (CSF3), transcript variant 1 |
CNY 3080.00 |
|
| LY403533 | Transient overexpression lysate of colony stimulating factor 3 (granulocyte) (CSF3), transcript variant 3 |
CNY 3080.00 |
|
| LY432626 | Transient overexpression lysate of colony stimulating factor 3 (granulocyte) (CSF3), transcript variant 4 |
CNY 3080.00 |
|
| PH307709 | CSF3 MS Standard C13 and N15-labeled recombinant protein (NP_757374) |
CNY 19520.00 |
|
| TP307709 | Recombinant protein of human colony stimulating factor 3 (granulocyte) (CSF3), transcript variant 3, 20 µg |
CNY 2900.00 |
|
| TP317237 | Recombinant protein of human colony stimulating factor 3 (granulocyte) (CSF3), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP329626 | Purified recombinant protein of Homo sapiens colony stimulating factor 3 (granulocyte) (CSF3), transcript variant 4, 20 µg |
CNY 2900.00 |
|
| TP720002 | Recombinant protein of human colony stimulating factor 3 (granulocyte) (CSF3), transcript variant 1, produced in E. coli |
CNY 1800.00 |
|
| TP723770 | Purified recombinant protein of Human colony stimulating factor 3 (granulocyte) (CSF3), transcript variant 3 |
CNY 5150.00 |
