THYN1 (NM_001037305) Human Mass Spec Standard
CAT#: PH317369
THYN1 MS Standard C13 and N15-labeled recombinant protein (NP_001032382)
View other "THYN1" proteins (15)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | THYN1 MS Standard C13 and N15-labeled recombinant protein (NP_001032382) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC217369 |
Predicted MW | 25.5 kDa |
Protein Sequence |
>RC217369 representing NM_001037305
Red=Cloning site Green=Tags(s) MSRPRKRLAGTSGSDKGLSGKRTKTENSGEALAKVEDSNPQKTSATKNCLKNLSSHWLMKSEPESRLEKG VDVKFSIEDLKAQPKQTTCWDGVRNYQARNFLRAMKLGEEAFFYHSNCKEPGIAGLMKIVKEAYPDHTQF EKNNPHYDPSSKEDNPKWSMVDVQFVRMMKRFIPLAELKSYHQAHKATGGPLKNMVLFTRQRLSIQPLTQ EEFDFVLSLEEKEPS myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001032382 |
RefSeq Size | 941 |
RefSeq ORF | 675 |
Synonyms | HSPC144; MDS012; MY105; THY28; THY28KD |
Locus ID | 29087 |
Cytogenetics | 11q25 |
Summary | This gene encodes a protein that is highly conserved among vertebrates and plant species and may be involved in the induction of apoptosis. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404616 | THYN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC404617 | THYN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC415464 | THYN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC421943 | THYN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC421944 | THYN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY404616 | Transient overexpression lysate of thymocyte nuclear protein 1 (THYN1), transcript variant 2 |
CNY 3080.00 |
|
LY404617 | Transient overexpression lysate of thymocyte nuclear protein 1 (THYN1), transcript variant 3 |
CNY 3080.00 |
|
LY415464 | Transient overexpression lysate of thymocyte nuclear protein 1 (THYN1), transcript variant 1 |
CNY 3080.00 |
|
LY421943 | Transient overexpression lysate of thymocyte nuclear protein 1 (THYN1), transcript variant 4 |
CNY 3080.00 |
|
LY421944 | Transient overexpression lysate of thymocyte nuclear protein 1 (THYN1), transcript variant 5 |
CNY 3080.00 |
|
PH316877 | THYN1 MS Standard C13 and N15-labeled recombinant protein (NP_054893) |
CNY 19520.00 |
|
PH322714 | THYN1 MS Standard C13 and N15-labeled recombinant protein (NP_954994) |
CNY 19520.00 |
|
TP316877 | Recombinant protein of human thymocyte nuclear protein 1 (THYN1), transcript variant 1, 20 µg |
CNY 2900.00 |
|
TP317369 | Recombinant protein of human thymocyte nuclear protein 1 (THYN1), transcript variant 5, 20 µg |
CNY 2900.00 |
|
TP322714 | Recombinant protein of human thymocyte nuclear protein 1 (THYN1), transcript variant 2, 20 µg |
CNY 2900.00 |