FGF2 (NM_002006) Human Mass Spec Standard
CAT#: PH317426
FGF2 MS Standard C13 and N15-labeled recombinant protein (NP_001997)
View other "FGF2" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | FGF2 MS Standard C13 and N15-labeled recombinant protein (NP_001997) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC217426 |
| Predicted MW | 30.6 kDa |
| Protein Sequence |
>RC217426 representing NM_002006
Red=Cloning site Green=Tags(s) MVGVGGGDVEDVTPRPGGCQISGRGARGCNGIPGAAAWEAALPRRRPRRHPSVNPRSRAAGSPRTRGRRT EERPSGSRLGDRGRGRALPGGRLGGRGRGRAPERVGGRGRGRGTAAPRAAPAARGSRPGPAGTMAAGSIT TLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGV CANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAIL FLPMSAKS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001997 |
| RefSeq Size | 6803 |
| RefSeq ORF | 864 |
| Synonyms | BFGF; FGF-2; FGFB; HBGF-2 |
| Locus ID | 2247 |
| Cytogenetics | 4q28.1 |
| Summary | The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members bind heparin and possess broad mitogenic and angiogenic activities. This protein has been implicated in diverse biological processes, such as limb and nervous system development, wound healing, and tumor growth. The mRNA for this gene contains multiple polyadenylation sites, and is alternatively translated from non-AUG (CUG) and AUG initiation codons, resulting in five different isoforms with distinct properties. The CUG-initiated isoforms are localized in the nucleus and are responsible for the intracrine effect, whereas, the AUG-initiated form is mostly cytosolic and is responsible for the paracrine and autocrine effects of this FGF. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Secreted Protein |
| Protein Pathways | MAPK signaling pathway, Melanoma, Pathways in cancer, Regulation of actin cytoskeleton |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400733 | FGF2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400733 | Transient overexpression lysate of fibroblast growth factor 2 (basic) (FGF2) |
CNY 3080.00 |
|
| TP317426 | Recombinant protein of human fibroblast growth factor 2 (basic) (FGF2), 20 µg |
CNY 2900.00 |
|
| TP723719 | Purified recombinant protein of Human fibroblast growth factor 2 (basic) (FGF2) |
CNY 3030.00 |
|
| TP750002 | Recombinant protein of human Fibroblast Growth Factor-basic (FGF2) produced in E. coli |
CNY 2040.00 |


