TCEAL5 (NM_001012979) Human Mass Spec Standard
CAT#: PH317441
TCEAL5 MS Standard C13 and N15-labeled recombinant protein (NP_001012997)
View other "TCEAL5" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | TCEAL5 MS Standard C13 and N15-labeled recombinant protein (NP_001012997) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC217441 |
Predicted MW | 23.3 kDa |
Protein Sequence |
>RC217441 protein sequence
Red=Cloning site Green=Tags(s) MEKLYKENEGKPENERNLESEGKPEDEGSTEDEGKSDEEEKPDMEGKTECEGKREDEGEPGDEGQLEDEG NQEKQGKSEGEDKPQSEGKPASQAKPESQPRAAEKRPAEDYVPRKAKRKTDRGTDDSPKDSQEDLQERHL SSEEMMRECGDVSRAQEELRKKQKMGGFHWMQRDVQDPFAPRGQRGVRGVRGGGRGQKDLEDVPYV myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001012997 |
RefSeq Size | 1166 |
RefSeq ORF | 618 |
Synonyms | WEX4 |
Locus ID | 340543 |
Cytogenetics | Xq22.1 |
Summary | This gene, which is located on the X chromosome, encodes a protein which contains a BEX (brain expressed X-liked like family) domain. This domain is found in proteins encoded by the TCEAL elongation factor (transcription elongation factor A (SII)-like) gene family also located on the X chromosome. The coding region for this gene is located entirely in the terminal exon. [provided by RefSeq, Sep 2011] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC422941 | TCEAL5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY422941 | Transient overexpression lysate of transcription elongation factor A (SII)-like 5 (TCEAL5) |
CNY 3080.00 |
|
TP317441 | Recombinant protein of human transcription elongation factor A (SII)-like 5 (TCEAL5), 20 µg |
CNY 2900.00 |