TRARG1 (NM_172367) Human Mass Spec Standard
CAT#: PH317523
TUSC5 MS Standard C13 and N15-labeled recombinant protein (NP_758955)
View other "TRARG1" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 14250.00
Specifications
| Product Data | |
| Description | TUSC5 MS Standard C13 and N15-labeled recombinant protein (NP_758955) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC217523 |
| Predicted MW | 19.1 kDa |
| Protein Sequence |
>RC217523 representing NM_172367
Red=Cloning site Green=Tags(s) MAHPVQSEFPSAQEPGSAASLDLPEMEILLTKAENKDDKTLNLSKTLSGPLDLEQNGQGLPFKAISEGHL EAPLPRSPSRASSRRASSIATTSYAQDQEAPRDYLILAVVACFCPVWPLNLIPLIISIMSRSSMQQGNVD GARRLGRLARLLSITLIIMGIVIIMVAVTVNFTVQKK SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_758955 |
| RefSeq Size | 3616 |
| RefSeq ORF | 531 |
| Synonyms | BEC-1; DSPB1; IFITMD3; LOST1; TUSC5 |
| Locus ID | 286753 |
| Cytogenetics | 17p13.3 |
| Summary | Regulates insulin-mediated adipose tissue glucose uptake and transport by modulation of SLC2A4 recycling. Not required for SLC2A4 membrane fusion upon an initial stimulus, but rather is necessary for proper protein recycling during prolonged insulin stimulation.[UniProtKB/Swiss-Prot Function] |
| Protein Families | Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC406733 | TUSC5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY406733 | Transient overexpression lysate of tumor suppressor candidate 5 (TUSC5) |
CNY 3080.00 |
|
| TP317523 | Purified recombinant protein of Homo sapiens tumor suppressor candidate 5 (TUSC5), 20 µg |
CNY 2900.00 |
