IFRD1 (NM_001550) Human Mass Spec Standard
CAT#: PH317538
IFRD1 MS Standard C13 and N15-labeled recombinant protein (NP_001541)
View other "IFRD1" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | IFRD1 MS Standard C13 and N15-labeled recombinant protein (NP_001541) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC217538 |
| Predicted MW | 50.3 kDa |
| Protein Sequence |
>RC217538 protein sequence
Red=Cloning site Green=Tags(s) MPKNKKRNTPHRGSSAGGGGSGAAAATAATAGGQHRNVQPFSDEDASIETMSHCSGYSDPSSFAEDGPEV LDEEGTQEDLEYKLKGLIDLTLDKSAKTRQAALEGIKNALASKMLYEFILERRMTLTDSIERCLKKGKSD EQRAAAALASVLCIQLGPGIESEEILKTLGPILKKIICDGSASMQARQTCATCFGVCCFIATDDITELYS TLECLENIFTKSYLKEKDTTVICSTPNTVLHISSLLAWTLLLTICPINEVKKKLEMHFHKLPSLLSCDDV NMRIAAGESLALLFELARGIESDFFYEDMESLTQMLRALATDGNKHRAKVDKRKQRSVFRDVLRAVEERD FPTETIKFGPERMYIDCWVKKHTYDTFKEVLGSGMQYHLQSNEFLRNVFELGPPVMLDAATLKTMKISRF ERHLYNSAAFKARTKARSKCRDKRADVGEFF myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001541 |
| RefSeq Size | 3305 |
| RefSeq ORF | 1353 |
| Synonyms | PC4; TIS7 |
| Locus ID | 3475 |
| Cytogenetics | 7q31.1 |
| Summary | This gene is an immediate early gene that encodes a protein related to interferon-gamma. This protein may function as a transcriptional co-activator/repressor that controls the growth and differentiation of specific cell types during embryonic development and tissue regeneration. Mutations in this gene are associated with sensory/motor neuropathy with ataxia. This gene may also be involved in modulating the pathogenesis of cystic fibrosis lung disease. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Oct 2010] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC419866 | IFRD1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC423466 | IFRD1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY419866 | Transient overexpression lysate of interferon-related developmental regulator 1 (IFRD1), transcript variant 1 |
CNY 3080.00 |
|
| LY423466 | Transient overexpression lysate of interferon-related developmental regulator 1 (IFRD1), transcript variant 2 |
CNY 3080.00 |
|
| TP317538 | Recombinant protein of human interferon-related developmental regulator 1 (IFRD1), transcript variant 1, 20 µg |
CNY 2900.00 |
