GCSH (NM_004483) Human Mass Spec Standard
CAT#: PH317886
GCSH MS Standard C13 and N15-labeled recombinant protein (NP_004474)
View other "GCSH" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | GCSH MS Standard C13 and N15-labeled recombinant protein (NP_004474) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC217886 |
| Predicted MW | 18.91 kDa |
| Protein Sequence |
>RC217886 representing NM_004483
Red=Cloning site Green=Tags(s) MALRVVRSVRALLCTLRAVPLPAAPCPPRPWQLGVGAVRTLRTGPALLSVRKFTEKHEWVTTENGIGTVG ISNFAQEALGDVVYCSLPEVGTKLNKQDEFGALESVKAASELYSPLSGEVTEINEALAENPGLVNKSCYE DGWLIKMTLSNPSELDELMSEEAYEKYIKSIEE myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_004474 |
| RefSeq Size | 1161 |
| RefSeq ORF | 519 |
| Synonyms | GCE; NKH |
| Locus ID | 2653 |
| Cytogenetics | 16q23.2 |
| Summary | Degradation of glycine is brought about by the glycine cleavage system, which is composed of four mitochondrial protein components: P protein (a pyridoxal phosphate-dependent glycine decarboxylase), H protein (a lipoic acid-containing protein), T protein (a tetrahydrofolate-requiring enzyme), and L protein (a lipoamide dehydrogenase). The protein encoded by this gene is the H protein, which transfers the methylamine group of glycine from the P protein to the T protein. Defects in this gene are a cause of nonketotic hyperglycinemia (NKH). Two transcript variants, one protein-coding and the other probably not protein-coding,have been found for this gene. Also, several transcribed and non-transcribed pseudogenes of this gene exist throughout the genome.[provided by RefSeq, Jan 2010] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC417961 | GCSH HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY417961 | Transient overexpression lysate of glycine cleavage system protein H (aminomethyl carrier) (GCSH), nuclear gene encoding mitochondrial protein, transcript variant 1 |
CNY 3080.00 |
|
| TP317886 | Recombinant protein of human glycine cleavage system protein H (aminomethyl carrier) (GCSH), 20 µg |
CNY 2900.00 |
