IRF7 (NM_001572) Human Mass Spec Standard
CAT#: PH317934
IRF7 MS Standard C13 and N15-labeled recombinant protein (NP_001563)
View other "IRF7" proteins (6)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | IRF7 MS Standard C13 and N15-labeled recombinant protein (NP_001563) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC217934 |
Predicted MW | 54.1 kDa |
Protein Sequence |
>RC217934 representing NM_001572
Red=Cloning site Green=Tags(s) MALAPERAAPRVLFGEWLLGEISSGCYEGLQWLDEARTCFRVPWKHFARKDLSEADARIFKAWAVARGRW PPSSRGGGPPPEAETAERAGWKTNFRCALRSTRRFVMLRDNSGDPADPHKVYALSRELCWREGPGTDQTE AEAPAAVPPPQGGPPGPFLAHTHAGLQAPGPLPAPAGDKGDLLLQAVQQSCLADHLLTASWGADPVPTKA PGEGQEGLPLTGACAGGPGLPAGELYGWAVETTPSPGPQPAALTTGEAAAPESPHQAEPYLSPSPSACTA VQEPSPGALDVTIMYKGRTVLQKVVGHPSCTFLYGPPDPAVRATDPQQVAFPSPAELPDQKQLRYTEELL RHVAPGLHLELRGPQLWARRMGKCKVYWEVGGPPGSASPSTPACLLPRNCDTPIFDFRVFFQELVEFRAR QRRGSPRYTIYLGFGQDLSAGRPKEKSLVLVKLEPWLCRVHLEGTQREGVSSLDSSSLSLCLSSANSLYD DIECFLMELEQPASGP SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001563 |
RefSeq Size | 1890 |
RefSeq ORF | 1518 |
Synonyms | IMD39; IRF-7; IRF-7H; IRF7A; IRF7B; IRF7C; IRF7H |
Locus ID | 3665 |
Cytogenetics | 11p15.5 |
Summary | IRF7 encodes interferon regulatory factor 7, a member of the interferon regulatory transcription factor (IRF) family. IRF7 has been shown to play a role in the transcriptional activation of virus-inducible cellular genes, including interferon beta chain genes. Inducible expression of IRF7 is largely restricted to lymphoid tissue. Multiple IRF7 transcript variants have been identified, although the functional consequences of these have not yet been established. [provided by RefSeq, Jul 2008] |
Protein Families | Transcription Factors |
Protein Pathways | Cytosolic DNA-sensing pathway, RIG-I-like receptor signaling pathway, Toll-like receptor signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400601 | IRF7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LC418288 | IRF7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LY400601 | Transient overexpression lysate of interferon regulatory factor 7 (IRF7), transcript variant a |
CNY 4840.00 |
|
LY418288 | Transient overexpression lysate of interferon regulatory factor 7 (IRF7), transcript variant d |
CNY 4840.00 |
|
TP317934 | Recombinant protein of human interferon regulatory factor 7 (IRF7), transcript variant a, 20 µg |
CNY 2900.00 |
|
TP761223 | Purified recombinant protein of Human interferon regulatory factor 7 (IRF7), transcript variant a, full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2040.00 |