CLIC1 (NM_001288) Human Mass Spec Standard
CAT#: PH318042
CLIC1 MS Standard C13 and N15-labeled recombinant protein (NP_001279)
View other "CLIC1" proteins (4)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | CLIC1 MS Standard C13 and N15-labeled recombinant protein (NP_001279) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC218042 |
Predicted MW | 26.7 kDa |
Protein Sequence |
>RC218042 representing NM_001288
Red=Cloning site Green=Tags(s) MAEEQPQVELFVKAGSDGAKIGNCPFSQRLFMVLWLKGVTFNVTTVDTKRRTETVQKLCPGGQLPFLLYG TEVHTDTNKIEEFLEAVLCPPRYPKLAALNPESNTAGLDIFAKFSAYIKNSNPALNDNLEKGLLKALKVL DNYLTSPLPEEVDETSAEDEGVSQRKFLDGNELTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYL SNAYAREEFASTCPDDEEIELAYEQVAKALK myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001279 |
RefSeq Size | 1265 |
RefSeq ORF | 723 |
Synonyms | CL1C1; CLCNL1; G6; NCC27 |
Locus ID | 1192 |
Cytogenetics | 6p21.33 |
Summary | Chloride channels are a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. Chloride intracellular channel 1 is a member of the p64 family; the protein localizes principally to the cell nucleus and exhibits both nuclear and plasma membrane chloride ion channel activity. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Ion Channels: Other |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400515 | CLIC1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400515 | Transient overexpression lysate of chloride intracellular channel 1 (CLIC1) |
CNY 3080.00 |
|
TP318042 | Recombinant protein of human chloride intracellular channel 1 (CLIC1), 20 µg |
CNY 2900.00 |
|
TP720956 | Purified recombinant protein of Human chloride intracellular channel 1 (CLIC1) |
CNY 1800.00 |