DYNLT1 (NM_006519) Human Mass Spec Standard
CAT#: PH318331
DYNLT1 MS Standard C13 and N15-labeled recombinant protein (NP_006510)
View other "DYNLT1" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | DYNLT1 MS Standard C13 and N15-labeled recombinant protein (NP_006510) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC218331 |
| Predicted MW | 12.3 kDa |
| Protein Sequence |
>RC218331 representing NM_006519
Red=Cloning site Green=Tags(s) MEDYQAAEETAFVVDEVSNIVKEAIESAIGGNAYQHSKVNQWTTNVVEQTLSQLTKLGKPFKYIVTCVIM QKNGAGLHTASSCFWDSSTDGSCTVRWENKTMYCIVSAFGLSI myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_006510 |
| RefSeq Size | 713 |
| RefSeq ORF | 339 |
| Synonyms | CW-1; TCTEL1; tctex-1; TCTEX1 |
| Locus ID | 6993 |
| Cytogenetics | 6q25.3 |
| Summary | This gene encodes a component of the motor complex, cytoplasmic dynein, which transports cellular cargo along microtubules in the cell. The encoded protein regulates the length of primary cilia which are sensory organelles found on the surface of cells. The protein encoded by this gene interacts with viral proteins, like the minor capsid protein L2 of human papillomavirus, and is required for dynein-mediated delivery of the viral nucleic acid to the host nucleus. This protein interacts with oncogenic nucleoporins to disrupt gene regulation and cause leukemic transformation. Pseudogenes of this gene are present on chromosomes 4 and 17. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Apr 2014] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401953 | DYNLT1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401953 | Transient overexpression lysate of dynein, light chain, Tctex-type 1 (DYNLT1) |
CNY 3080.00 |
|
| TP318331 | Recombinant protein of human dynein, light chain, Tctex-type 1 (DYNLT1), 20 µg |
CNY 2900.00 |
