ING3 (NM_019071) Human Mass Spec Standard
CAT#: PH318424
ING3 MS Standard C13 and N15-labeled recombinant protein (NP_061944)
View other "ING3" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | ING3 MS Standard C13 and N15-labeled recombinant protein (NP_061944) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC218424 |
Predicted MW | 46.6 kDa |
Protein Sequence |
>RC218424 representing NM_019071
Red=Cloning site Green=Tags(s) MLYLEDYLEMIEQLPMDLRDRFTEMREMDLQVQNAMDQLEQRVSEFFMNAKKNKPEWREEQMASIKKDYY KALEDADEKVQLANQIYDLVDRHLRKLDQELAKFKMELEADNAGITEILERRSLELDTPSQPVNNHHAHS HTPVEKRKYNPTSHHTTTDHIPEKKFKSEALLSTLTSDASKENTLGCRNNNSTASSNNAYNVNSSQPLGS YNIGSLSSGTGAGAITMAAAQAVQATAQMKEGRRTSSLKASYEAFKNNDFQLGKEFSMARETVGYSSSSA LMTTLTQNASSSAADSRSGRKSKNNNKSSSQQSSSSSSSSSLSSCSSSSTVVQEISQQTTVVPESDSNSQ VDWTYDPNEPRYCICNQVSYGEMVGCDNQDCPIEWFHYGCVGLTEAPKGKWYCPQCTAAMKRRGSRHK myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_061944 |
RefSeq Size | 2221 |
RefSeq ORF | 1254 |
Synonyms | Eaf4; ING2; MEAF4; p47ING3 |
Locus ID | 54556 |
Cytogenetics | 7q31.31 |
Summary | The protein encoded by this gene is similar to ING1, a tumor suppressor protein that can interact with TP53, inhibit cell growth, and induce apoptosis. This protein contains a PHD-finger, which is a common motif in proteins involved in chromatin remodeling. This gene can activate p53 trans-activated promoters, including promoters of p21/waf1 and bax. Overexpression of this gene has been shown to inhibit cell growth and induce apoptosis. Allelic loss and reduced expression of this gene were detected in head and neck cancers. Two alternatively spliced transcript variants encoding different isoforms have been observed. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC412783 | ING3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LY412783 | Transient overexpression lysate of inhibitor of growth family, member 3 (ING3), transcript variant 1 |
CNY 4840.00 |
|
TP318424 | Recombinant protein of human inhibitor of growth family, member 3 (ING3), transcript variant 1, 20 µg |
CNY 2900.00 |