Myosin light chain kinase (MYLK) (NM_053031) Human Mass Spec Standard
CAT#: PH318513
MYLK MS Standard C13 and N15-labeled recombinant protein (NP_444259)
View other "Myosin light chain kinase" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | MYLK MS Standard C13 and N15-labeled recombinant protein (NP_444259) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC218513 |
| Predicted MW | 16.7 kDa |
| Protein Sequence |
>RC218513 representing NM_053031
Red=Cloning site Green=Tags(s) MAMISGLSGRKSSTGSPTSPLNAEKLESEEDVSQAFLEAVAEEKPHVKPYFSKTIRDLEVVEGSAARFDC KIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCSLIISDVCGDDDAKYTCKAVNSLGEATCTAELIVE TMEEGEGEGEEEEE myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_444259 |
| RefSeq Size | 2676 |
| RefSeq ORF | 462 |
| Synonyms | AAT7; KRP; MLCK; MLCK1; MLCK108; MLCK210; MMIHS; MMIHS1; MSTP083; MYLK1; smMLCK |
| Locus ID | 4638 |
| Cytogenetics | 3q21.1 |
| Summary | This gene, a muscle member of the immunoglobulin gene superfamily, encodes myosin light chain kinase which is a calcium/calmodulin dependent enzyme. This kinase phosphorylates myosin regulatory light chains to facilitate myosin interaction with actin filaments to produce contractile activity. This gene encodes both smooth muscle and nonmuscle isoforms. In addition, using a separate promoter in an intron in the 3' region, it encodes telokin, a small protein identical in sequence to the C-terminus of myosin light chain kinase, that is independently expressed in smooth muscle and functions to stabilize unphosphorylated myosin filaments. A pseudogene is located on the p arm of chromosome 3. Four transcript variants that produce four isoforms of the calcium/calmodulin dependent enzyme have been identified as well as two transcripts that produce two isoforms of telokin. Additional variants have been identified but lack full length transcripts. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Protein Kinase |
| Protein Pathways | Calcium signaling pathway, Focal adhesion, Regulation of actin cytoskeleton, Vascular smooth muscle contraction |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC409331 | MYLK HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY409331 | Transient overexpression lysate of myosin light chain kinase (MYLK), transcript variant 7 |
CNY 3080.00 |
|
| TP318513 | Recombinant protein of human myosin light chain kinase (MYLK), transcript variant 7, 20 µg |
CNY 2900.00 |
其它Myosin light chain kinase产品
