TTC36 (NM_001080441) Human Mass Spec Standard
CAT#: PH318535
TTC36 MS Standard C13 and N15-labeled recombinant protein (NP_001073910)
View other "TTC36" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | TTC36 MS Standard C13 and N15-labeled recombinant protein (NP_001073910) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC218535 |
| Predicted MW | 20.7 kDa |
| Protein Sequence |
>RC218535 representing NM_001080441
Red=Cloning site Green=Tags(s) MGTPNDQAVLQAIFNPDTPFGDIVGLDLGEEAEKEEREEDEVFPQAQLEQSKALELQGVMAAEAGDLSTA LERFGQAICLLPERASAYNNRAQARRLQGDVAGALEDLERAVELSGGRGRAARQSFVQRGLLARLQGRDD DARRDFERAARLGSPFARRQLVLLNPYAALCNRMLADMMGQLRRPRDSR myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001073910 |
| RefSeq Size | 679 |
| RefSeq ORF | 567 |
| Synonyms | HBP21 |
| Locus ID | 143941 |
| Cytogenetics | 11q23.3 |
| Summary | The protein encoded by this gene has three tetratricopeptide repeats and is a chaperone for heat shock protein 70. The encoded protein may function as a tumor suppressor in hepatocellular carcinoma (HCC) since it promotes apoptosis but is downregulated in HCC. [provided by RefSeq, Sep 2016] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC421658 | TTC36 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY421658 | Transient overexpression lysate of tetratricopeptide repeat domain 36 (TTC36) |
CNY 3080.00 |
|
| TP318535 | Recombinant protein of human tetratricopeptide repeat domain 36 (TTC36), 20 µg |
CNY 2900.00 |
