ELAVL4 (NM_021952) Human Mass Spec Standard
CAT#: PH318612
ELAVL4 MS Standard C13 and N15-labeled recombinant protein (NP_068771)
View other "ELAVL4" proteins (9)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | ELAVL4 MS Standard C13 and N15-labeled recombinant protein (NP_068771) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC218612 |
Predicted MW | 41.6 kDa |
Protein Sequence |
>RC218612 representing NM_021952
Red=Cloning site Green=Tags(s) MVMIISTMEPQVSNGPTSNTSNGPSSNNRNCPSPMQTGATTDDSKTNLIVNYLPQNMTQEEFRSLFGSIG EIESCKLVRDKITGQSLGYGFVNYIDPKDAEKAINTLNGLRLQTKTIKVSYARPSSASIRDANLYVSGLP KTMTQKELEQLFSQYGRIITSRILVDQVTGVSRGVGFIRFDKRIEAEEAIKGLNGQKPSGATEPITVKFA NNPSQKSSQALLSQLYQSPNRRYPGPLHHQAQRFRLDNLLNMAYGVKRLMSGPVPPSACSPRFSPITIDG MTSLVGMNIPGHTGTGWCIFVYNLSPDSDESVLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVTMTNYDE AAMAIASLNGYRLGDRVLQVSFKTNKAHKS myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_068771 |
RefSeq Size | 1591 |
RefSeq ORF | 1140 |
Synonyms | HUD; PNEM |
Locus ID | 1996 |
Cytogenetics | 1p33-p32.3 |
Summary | May play a role in neuron-specific RNA processing. Protects CDKN1A mRNA from decay by binding to its 3' UTR (By similarity). Binds to AU-rich sequences (AREs) of target mRNAs, including VEGF and FOS mRNA.[UniProtKB/Swiss-Prot Function] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411863 | ELAVL4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC428514 | ELAVL4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC428515 | ELAVL4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC428517 | ELAVL4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY411863 | Transient overexpression lysate of ELAV (embryonic lethal, abnormal vision, Drosophila)-like 4 (Hu antigen D) (ELAVL4), transcript variant 1 |
CNY 3080.00 |
|
LY428514 | Transient overexpression lysate of ELAV (embryonic lethal, abnormal vision, Drosophila)-like 4 (Hu antigen D) (ELAVL4), transcript variant 2 |
CNY 3080.00 |
|
LY428515 | Transient overexpression lysate of ELAV (embryonic lethal, abnormal vision, Drosophila)-like 4 (Hu antigen D) (ELAVL4), transcript variant 3 |
CNY 3080.00 |
|
LY428517 | Transient overexpression lysate of ELAV (embryonic lethal, abnormal vision, Drosophila)-like 4 (Hu antigen D) (ELAVL4), transcript variant 5 |
CNY 3080.00 |
|
TP318612 | Recombinant protein of human ELAV (embryonic lethal, abnormal vision, Drosophila)-like 4 (Hu antigen D) (ELAVL4), transcript variant 1, 20 µg |
CNY 2900.00 |