INMT (NM_006774) Human Mass Spec Standard
CAT#: PH318678
INMT MS Standard C13 and N15-labeled recombinant protein (NP_006765)
View other "INMT" proteins (4)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | INMT MS Standard C13 and N15-labeled recombinant protein (NP_006765) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC218678 |
| Predicted MW | 28.7 kDa |
| Protein Sequence |
>RC218678 representing NM_006774
Red=Cloning site Green=Tags(s) MKGGFTGGDEYQKHFLPRDYLATYYSFNGSPSPEAEMLKFNLECLHKTFGPGGLQGDTLIDIGSGPTIYQ VLAACDSFQDITLSDFTDRNREELEKWLKKEPGAYDWTPAVKFACELEGNSGRWEEKEEKLRAAVKRVLK CDVHLGNPLAPAVLPLADCVLTLLAMECACCSLDAYRAALCNLASLLKPGGHLVTTVTLRLPSYVVGKRE FSCVALEKEEVEQAVLDAGFDIEQLLHSPQSYSVTNAANNGVCCIVARKKPGP myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_006765 |
| RefSeq Size | 2639 |
| RefSeq ORF | 789 |
| Synonyms | TEMT |
| Locus ID | 11185 |
| Cytogenetics | 7p14.3 |
| Summary | N-methylation of endogenous and xenobiotic compounds is a major method by which they are degraded. This gene encodes an enzyme that N-methylates indoles such as tryptamine. Alternative splicing results in multiple transcript variants. Read-through transcription also exists between this gene and the downstream MINDY4 (aka FAM188B) gene. In rodents and other mammals such as cetartiodactyla this gene is in the opposite orientation compared to its orientation in human and other primates and this gene appears to have been lost in carnivora and chiroptera. [provided by RefSeq, Jul 2019] |
| Protein Pathways | Tryptophan metabolism |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC416430 | INMT HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY416430 | Transient overexpression lysate of indolethylamine N-methyltransferase (INMT) |
CNY 3080.00 |
|
| TP318678 | Recombinant protein of human indolethylamine N-methyltransferase (INMT), 20 µg |
CNY 2900.00 |
|
| TP761226 | Purified recombinant protein of Human indolethylamine N-methyltransferase (INMT), transcript variant 1, full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2040.00 |
