EGFL7 (NM_016215) Human Mass Spec Standard
CAT#: PH318849
EGFL7 MS Standard C13 and N15-labeled recombinant protein (NP_057299)
View other "EGFL7" proteins (6)
|
Need it in bulk or customized? Get a free quote |
CNY 14250.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | EGFL7 MS Standard C13 and N15-labeled recombinant protein (NP_057299) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC218849 |
| Predicted MW | 29.4 kDa |
| Protein Sequence |
>RC218849 representing NM_016215
Red=Cloning site Green=Tags(s) MRGSQEVLLMWLLVLAVGGTEHAYRPGRRVCAVRAHGDPVSESFVQRVYQPFLTTCDGHRACSTYRTIYR TAYRRSPGLAPARPRYACCPGWKRTSGLPGACGAAICQPPCRNGGSCVQPGRCRCPAGWRGDTCQSDVDE CSARRGGCPQRCVNTAGSYWCQCWEGHSLSADGTLCVPKGGPPRVAPNPTGVDSAMKEEVQRLQSRVDLL EEKLQLVLAPLHSLASQALEHGLPDPGSLLVHSFQQLGRIDSLSEQISFLEEQLGSCSCKKDS SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_057299 |
| RefSeq Size | 1569 |
| RefSeq ORF | 819 |
| Synonyms | NEU1; VE-STATIN; ZNEU1 |
| Locus ID | 51162 |
| Cytogenetics | 9q34.3 |
| Summary | This gene encodes a secreted endothelial cell protein that contains two epidermal growth factor-like domains. The encoded protein may play a role in regulating vasculogenesis. This protein may be involved in the growth and proliferation of tumor cells. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Feb 2012] |
| Protein Families | Secreted Protein |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402519 | EGFL7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC404428 | EGFL7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402519 | Transient overexpression lysate of EGF-like-domain, multiple 7 (EGFL7), transcript variant 1 |
CNY 3080.00 |
|
| LY404428 | Transient overexpression lysate of EGF-like-domain, multiple 7 (EGFL7), transcript variant 2 |
CNY 3080.00 |
|
| TP318849 | Purified recombinant protein of Homo sapiens EGF-like-domain, multiple 7 (EGFL7), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP761665 | Purified recombinant protein of Human EGF-like-domain, multiple 7 (EGFL7), transcript variant 1, transcript variant 1, full length, with N-terminal GST and C-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2040.00 |
