SPINT1 (NM_181642) Human Mass Spec Standard
CAT#: PH318993
SPINT1 MS Standard C13 and N15-labeled recombinant protein (NP_857593)
View other "SPINT1" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 4840.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | SPINT1 MS Standard C13 and N15-labeled recombinant protein (NP_857593) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC218993 |
| Predicted MW | 54.8 kDa |
| Protein Sequence |
>RC218993 representing NM_181642
Red=Cloning site Green=Tags(s) MAPARTMARARLAPAGIPAVALWLLCTLGLQGTQAGPPPAPPGLPAGADCLNSFTAGVPGFVLDTNASVS NGATFLESPTVRRGWDCVRACCTTQNCNLALVELQPDRGEDAIAACFLINCLYEQNFVCKFAPREGFINY LTREVYRSYRQLRTQGFGGSGIPKAWAGIDLKVQPQEPLVLKDVENTDWRLLRGDTDVRVERKDPNQVEL WGLKEGTYLFQLTVTSSDHPEDTANVTVTVLSTKQTEDYCLASNKVGRCRGSFPRWYYDPTEQICKSFVY GGCLGNKNNYLREEECILACRGVQGGPLRGSSGAQATFPQGPSMERRHPVCSGTCQPTQFRCSNGCCIDS FLECDDTPNCPDASDEAACEKYTSGFDELQRIHFPSDKGHCVDLPDTGLCKESIPRWYYNPFSEHCARFT YGGCYGNKNNFEEEQQCLESCRGISKKDVFGLRREIPIPSTGSVEMAVAVFLVICIVVVVAILGYCFFKN QRKDFHGHHHHPPPTPASSTVSTTEDTEHLVYNHTTRPL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_857593 |
| RefSeq Size | 2484 |
| RefSeq ORF | 1587 |
| Synonyms | HAI; HAI1; MANSC2 |
| Locus ID | 6692 |
| Cytogenetics | 15q15.1 |
| Summary | The protein encoded by this gene is a member of the Kunitz family of serine protease inhibitors. The protein is a potent inhibitor specific for HGF activator and is thought to be involved in the regulation of the proteolytic activation of HGF in injured tissues. Alternative splicing results in multiple variants encoding different isoforms. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Secreted Protein, Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC405735 | SPINT1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC422310 | SPINT1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY405735 | Transient overexpression lysate of serine peptidase inhibitor, Kunitz type 1 (SPINT1), transcript variant 1 |
CNY 4840.00 |
|
| LY422310 | Transient overexpression lysate of serine peptidase inhibitor, Kunitz type 1 (SPINT1), transcript variant 3 |
CNY 3080.00 |
|
| PH303537 | SPINT1 MS Standard C13 and N15-labeled recombinant protein (NP_001027539) |
CNY 19520.00 |
|
| TP303537 | Recombinant protein of human serine peptidase inhibitor, Kunitz type 1 (SPINT1), transcript variant 3, 20 µg |
CNY 2900.00 |
|
| TP318993 | Recombinant protein of human serine peptidase inhibitor, Kunitz type 1 (SPINT1), transcript variant 1, 20 µg |
CNY 2900.00 |
