FGF14 (NM_004115) Human Mass Spec Standard
CAT#: PH319002
FGF14 MS Standard C13 and N15-labeled recombinant protein (NP_004106)
View other "FGF14" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | FGF14 MS Standard C13 and N15-labeled recombinant protein (NP_004106) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC219002 |
Predicted MW | 27.5 kDa |
Protein Sequence |
>RC219002 representing NM_004115
Red=Cloning site Green=Tags(s) MAAAIASGLIRQKRQAREQHWDRPSASRRRSSPSKNRGLCNGNLVDIFSKVRIFGLKKRRLRRQDPQLKG IVTRLYCRQGYYLQMHPDGALDGTKDDSTNSTLFNLIPVGLRVVAIQGVKTGLYIAMNGEGYLYPSELFT PECKFKESVFENYYVIYSSMLYRQQESGRAWFLGLNKEGQAMKGNRVKKTKPAAHFLPKPLEVAMYREPS LHDVGETVPKPGVTPSKSTSASAIMNGGKPVNKSKTT myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_004106 |
RefSeq Size | 890 |
RefSeq ORF | 741 |
Synonyms | FGF-14; FHF-4; FHF4; SCA27 |
Locus ID | 2259 |
Cytogenetics | 13q33.1 |
Summary | The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. A mutation in this gene is associated with autosomal dominant cerebral ataxia. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Secreted Protein |
Protein Pathways | MAPK signaling pathway, Melanoma, Pathways in cancer, Regulation of actin cytoskeleton |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406214 | FGF14 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC418208 | FGF14 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY406214 | Transient overexpression lysate of fibroblast growth factor 14 (FGF14), transcript variant 2 |
CNY 3080.00 |
|
LY418208 | Transient overexpression lysate of fibroblast growth factor 14 (FGF14), transcript variant 1 |
CNY 3080.00 |
|
TP319002 | Recombinant protein of human fibroblast growth factor 14 (FGF14), transcript variant 1, 20 µg |
CNY 2900.00 |