DOPA Decarboxylase (DDC) (NM_001082971) Human Mass Spec Standard
CAT#: PH319037
DDC MS Standard C13 and N15-labeled recombinant protein (NP_001076440)
View other "DOPA Decarboxylase" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | DDC MS Standard C13 and N15-labeled recombinant protein (NP_001076440) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC219037 |
Predicted MW | 53.9 kDa |
Protein Sequence |
>RC219037 protein sequence
Red=Cloning site Green=Tags(s) MNASEFRRRGKEMVDYVANYMEGIEGRQVYPDVEPGYLRPLIPAAAPQEPDTFEDIINDVEKIIMPGVTH WHSPYFFAYFPTASSYPAMLADMLCGAIGCIGFSWAASPACTELETVMMDWLGKMLELPKAFLNEKAGEG GGVIQGSASEATLVALLAARTKVIHRLQAASPELTQAAIMEKLVAYSSDQAHSSVERAGLIGGVKLKAIP SDGNFAMRASALQEALERDKAAGLIPFFMVATLGTTTCCSFDNLLEVGPICNKEDIWLHVDAAYAGSAFI CPEFRHLLNGVEFADSFNFNPHKWLLVNFDCSAMWVKKRTDLTGAFRLDPTYLKHSHQDSGLITDYRHWQ IPLGRRFRSLKMWFVFRMYGVKGLQAYIRKHVQLSHEFESLVRQDPRFEICVEVILGLVCFRLKGSNKVN EALLQRINSAKKIHLVPCHLRDKFVLRFAICSRTVESAHVQRAWEHIKELAADVLRAERE myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001076440 |
RefSeq Size | 2090 |
RefSeq ORF | 1440 |
Synonyms | AADC |
Locus ID | 1644 |
Cytogenetics | 7p12.2-p12.1 |
Summary | The encoded protein catalyzes the decarboxylation of L-3,4-dihydroxyphenylalanine (DOPA) to dopamine, L-5-hydroxytryptophan to serotonin and L-tryptophan to tryptamine. Defects in this gene are the cause of aromatic L-amino-acid decarboxylase deficiency (AADCD). AADCD deficiency is an inborn error in neurotransmitter metabolism that leads to combined serotonin and catecholamine deficiency. Multiple alternatively spliced transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq, Jun 2011] |
Protein Families | Druggable Genome |
Protein Pathways | Histidine metabolism, Metabolic pathways, Phenylalanine metabolism, Tryptophan metabolism, Tyrosine metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400270 | DDC HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC421202 | DDC HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LY400270 | Transient overexpression lysate of dopa decarboxylase (aromatic L-amino acid decarboxylase) (DDC), transcript variant 2 |
CNY 3080.00 |
|
LY421202 | Transient overexpression lysate of dopa decarboxylase (aromatic L-amino acid decarboxylase) (DDC), transcript variant 1 |
CNY 4840.00 |
|
PH301345 | DDC MS Standard C13 and N15-labeled recombinant protein (NP_000781) |
CNY 19520.00 |
|
TP301345 | Recombinant protein of human dopa decarboxylase (aromatic L-amino acid decarboxylase) (DDC), transcript variant 2, 20 µg |
CNY 2900.00 |
|
TP319037 | Recombinant protein of human dopa decarboxylase (aromatic L-amino acid decarboxylase) (DDC), transcript variant 1, 20 µg |
CNY 2900.00 |
其它DOPA Decarboxylase产品