CD1B (NM_001764) Human Mass Spec Standard
CAT#: PH319131
CD1B MS Standard C13 and N15-labeled recombinant protein (NP_001755)
View other "CD1B" proteins (4)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | CD1B MS Standard C13 and N15-labeled recombinant protein (NP_001755) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC219131 |
| Predicted MW | 36.9 kDa |
| Protein Sequence |
>RC219131 protein sequence
Red=Cloning site Green=Tags(s) MLLLPFQLLAVLFPGGNSEHAFQGPTSFHVIQTSSFTNSTWAQTQGSGWLDDLQIHGWDSDSGTAIFLKP WSKGNFSDKEVAELEEIFRVYIFGFAREVQDFAGDFQMKYPFEIQGIAGCELHSGGAIVSFLRGALGGLD FLSVKNASCVPSPEGGSRAQKFCALIIQYQGIMETVRILLYETCPRYLLGVLNAGKADLQRQVKPEAWLS SGPSPGPGRLQLVCHVSGFYPKPVWVMWMRGEQEQQGTQLGDILPNANWTWYLRATLDVADGEAAGLSCR VKHSSLEGQDIILYWRNPTSIGSIVLAIIVPSLLLLLCLALWYMRRRSYQNIP myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001755 |
| RefSeq Size | 1396 |
| RefSeq ORF | 999 |
| Synonyms | CD1; CD1A; R1 |
| Locus ID | 910 |
| Cytogenetics | 1q23.1 |
| Summary | This gene encodes a member of the CD1 family of transmembrane glycoproteins, which are structurally related to the major histocompatibility complex (MHC) proteins and form heterodimers with beta-2-microglobulin. The CD1 proteins mediate the presentation of primarily lipid and glycolipid antigens of self or microbial origin to T cells. The human genome contains five CD1 family genes organized in a cluster on chromosome 1. The CD1 family members are thought to differ in their cellular localization and specificity for particular lipid ligands. The protein encoded by this gene localizes to late endosomes and lysosomes via a tyrosine-based motif in the cytoplasmic tail, and requires vesicular acidification to bind lipid antigens. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Transmembrane |
| Protein Pathways | Hematopoietic cell lineage |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC419761 | CD1B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY419761 | Transient overexpression lysate of CD1b molecule (CD1B) |
CNY 3080.00 |
|
| TP319131 | Recombinant protein of human CD1b molecule (CD1B), 20 µg |
CNY 2900.00 |
|
| TP700271 | Purified recombinant protein of human CD1B molecule (CD1B), with C-terminal Fc tag, expressed in human cells, 20 µg |
CNY 6650.00 |
