BCAT1 (NM_005504) Human Mass Spec Standard
CAT#: PH319229
BCAT1 MS Standard C13 and N15-labeled recombinant protein (NP_005495)
View other "BCAT1" proteins (12)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
CNY 3080.00
Specifications
| Product Data | |
| Description | BCAT1 MS Standard C13 and N15-labeled recombinant protein (NP_005495) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC219229 |
| Predicted MW | 42.8 kDa |
| Protein Sequence |
>RC219229 representing NM_005504
Red=Cloning site Green=Tags(s) MKDCSNGCSAECTGEGGSKEVVGTFKAKDLIVTPATILKEKPDPNNLVFGTVFTDHMLTVEWSSEFGWEK PHIKPLQNLSLHPGSSALHYAVELFEGLKAFRGVDNKIRLFQPNLNMDRMYRSAVRATLPVFDKEELLEC IQQLVKLDQEWVPYSTSASLYIRPTFIGTEPSLGVKKPTKALLFVLLSPVGPYFSSGTFNPVSLWANPKY VRAWKGGTGDCKMGGNYGSSLFAQCEAVDNGCQQVLWLYGEDHQITEVGTMNLFLYWINEDGEEELATPP LDGIILPGVTRRCILDLAHQWGEFKVSERYLTMDDLTTALEGNRVREMFGSGTACVVCPVSDILYKGETI HIPTMENGPKLASRILSKLTDIQYGREESDWTIVLS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_005495 |
| RefSeq Size | 8191 |
| RefSeq ORF | 1158 |
| Synonyms | BCATC; BCT1; ECA39; MECA39; PNAS121; PP18 |
| Locus ID | 586 |
| Cytogenetics | 12p12.1 |
| Summary | This gene encodes the cytosolic form of the enzyme branched-chain amino acid transaminase. This enzyme catalyzes the reversible transamination of branched-chain alpha-keto acids to branched-chain L-amino acids essential for cell growth. Two different clinical disorders have been attributed to a defect of branched-chain amino acid transamination: hypervalinemia and hyperleucine-isoleucinemia. As there is also a gene encoding a mitochondrial form of this enzyme, mutations in either gene may contribute to these disorders. Alternatively spliced transcript variants have been described. [provided by RefSeq, May 2010] |
| Protein Families | Druggable Genome |
| Protein Pathways | Metabolic pathways, Pantothenate and CoA biosynthesis, Valine, leucine and isoleucine biosynthesis, Valine, leucine and isoleucine degradation |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401683 | BCAT1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC432891 | BCAT1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC432924 | BCAT1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC432972 | BCAT1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC432999 | BCAT1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401683 | Transient overexpression lysate of branched chain aminotransferase 1, cytosolic (BCAT1) |
CNY 3080.00 |
|
| LY432891 | Transient overexpression lysate of branched chain amino-acid transaminase 1, cytosolic (BCAT1), transcript variant 3 |
CNY 3080.00 |
|
| LY432924 | Transient overexpression lysate of branched chain amino-acid transaminase 1, cytosolic (BCAT1), transcript variant 2 |
CNY 3080.00 |
|
| LY432972 | Transient overexpression lysate of branched chain amino-acid transaminase 1, cytosolic (BCAT1), transcript variant 5 |
CNY 3080.00 |
|
| LY432999 | Transient overexpression lysate of branched chain amino-acid transaminase 1, cytosolic (BCAT1), transcript variant 4 |
CNY 3080.00 |
|
| TP319229 | Recombinant protein of human branched chain aminotransferase 1, cytosolic (BCAT1), 20 µg |
CNY 2900.00 |
|
| TP760653 | Purified recombinant protein of Human branched chain amino-acid transaminase 1, cytosolic (BCAT1), transcript variant 1, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2040.00 |
