FBXO44 (NM_183413) Human Mass Spec Standard
CAT#: PH319237
FBXO44 MS Standard C13 and N15-labeled recombinant protein (NP_904320)
View other "FBXO44" proteins (11)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | FBXO44 MS Standard C13 and N15-labeled recombinant protein (NP_904320) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC219237 |
Predicted MW | 25.7 kDa |
Protein Sequence |
>RC219237 protein sequence
Red=Cloning site Green=Tags(s) MAVGNINELPENILLELFTHVPARQLLLNCRLVCSLWRDLIDLVTLWKRKCLREGFITEDWDQPVADWKI FYFLRSLHRNLLHNPCAEEGFEFWSLDVNGGDEWKVEDLSRDQRKEFPNDQVRSQARLRVQVPAVRSAPV VRARASGDLPARPGDHPAEERCQVEGGLPHILQLPARRPLHLVSARRRGHSLLGRLVRPEGHQQQHHHRA PAALTPPEPPSAEP myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_904320 |
RefSeq Size | 2823 |
RefSeq ORF | 672 |
Synonyms | FBG3; FBX6A; FBX30; Fbx44; Fbxo6a |
Locus ID | 93611 |
Cytogenetics | 1p36.22 |
Summary | This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbxs class. It is also a member of the NFB42 (neural F Box 42 kDa) family, similar to F-box only protein 2 and F-box only protein 6. Several alternatively spliced transcript variants encoding two distinct isoforms have been found for this gene. [provided by RefSeq, Feb 2015] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403232 | FBXO44 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC405197 | FBXO44 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC405198 | FBXO44 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC423077 | FBXO44 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC430665 | FBXO44 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403232 | Transient overexpression lysate of F-box protein 44 (FBXO44), transcript variant 1 |
CNY 3080.00 |
|
LY405197 | Transient overexpression lysate of F-box protein 44 (FBXO44), transcript variant 2 |
CNY 3080.00 |
|
LY405198 | Transient overexpression lysate of F-box protein 44 (FBXO44), transcript variant 3 |
CNY 3080.00 |
|
LY423077 | Transient overexpression lysate of F-box protein 44 (FBXO44), transcript variant 4 |
CNY 3080.00 |
|
TP319237 | Recombinant protein of human F-box protein 44 (FBXO44), transcript variant 3, 20 µg |
CNY 2900.00 |
|
TP760409 | Purified recombinant protein of Human F-box protein 44 (FBXO44), transcript variant 1, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2040.00 |