TRAF5 (NM_004619) Human Mass Spec Standard
CAT#: PH319243
TRAF5 MS Standard C13 and N15-labeled recombinant protein (NP_004610)
View other "TRAF5" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
CNY 4840.00
Specifications
Product Data | |
Description | TRAF5 MS Standard C13 and N15-labeled recombinant protein (NP_004610) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC219243 |
Predicted MW | 64.4 kDa |
Protein Sequence |
>RC219243 protein sequence
Red=Cloning site Green=Tags(s) MAYSEEHKGMPCGFIRQNSGNSISLDFEPSIEYQFVERLEERYKCAFCHSVLHNPHQTGCGHRFCQHCIL SLRELNTVPICPVDKEVIKSQEVFKDNCCKREVLNLYVYCSNAPGCNAKVILGRYQDHLQQCLFQPVQCS NEKCREPVLRKDLKEHLSASCQFRKEKCLYCKKDVVVINLQNHEENLCPEYPVFCPNNCAKIILKTEVDE HLAVCPEAEQDCPFKHYGCAVTDKRRNLQQHEHSALREHMRLVLEKNVQLEEQISDLHKSLEQKESKIQQ LAETIKKLEKEFKQFAQLFGKNGSFLPNIQVFASHIDKSAWLEAQVHQLLQMVNQQQNKFDLRPLMEAVD TVKQKITLLENNDQRLAVLEEETNKHDTHINIHKAQLSKNEERFKLLEGTCYNGKLIWKVTDYKMKKREA VDGHTVSIFSQSFYTSRCGYRLCARAYLNGDGSGRGSHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQS GKKNIMETFKPDPNSSSFKRPDGEMNIASGCPRFVAHSVLENAKNAYIKDDTLFLKVAVDLTDLEDL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_004610 |
RefSeq Size | 3988 |
RefSeq ORF | 1671 |
Synonyms | MGC:39780; RNF84 |
Locus ID | 7188 |
Cytogenetics | 1q32.3 |
Summary | The scaffold protein encoded by this gene is a member of the tumor necrosis factor receptor-associated factor (TRAF) protein family and contains a meprin and TRAF homology (MATH) domain, a RING-type zinc finger, and two TRAF-type zinc fingers. TRAF proteins are associated with, and mediate signal transduction from members of the TNF receptor superfamily. This protein is one of the components of a multiple protein complex which binds to tumor necrosis factor (TNF) receptor cytoplasmic domains and mediates TNF-induced activation. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2016] |
Protein Families | Druggable Genome |
Protein Pathways | Pathways in cancer, Small cell lung cancer |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC407875 | TRAF5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LC417875 | TRAF5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LC422427 | TRAF5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY407875 | Transient overexpression lysate of TNF receptor-associated factor 5 (TRAF5), transcript variant 2 |
CNY 4840.00 |
|
LY417875 | Transient overexpression lysate of TNF receptor-associated factor 5 (TRAF5), transcript variant 1 |
CNY 4840.00 |
|
LY422427 | Transient overexpression lysate of TNF receptor-associated factor 5 (TRAF5), transcript variant 3 |
CNY 3080.00 |
|
TP319243 | Recombinant protein of human TNF receptor-associated factor 5 (TRAF5), transcript variant 1, 20 µg |
CNY 2900.00 |