HVCN1 (NM_032369) Human Mass Spec Standard
CAT#: PH319422
HVCN1 MS Standard C13 and N15-labeled recombinant protein (NP_115745)
View other "HVCN1" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | HVCN1 MS Standard C13 and N15-labeled recombinant protein (NP_115745) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC219422 |
Predicted MW | 31.7 kDa |
Protein Sequence |
>RC219422 protein sequence
Red=Cloning site Green=Tags(s) MATWDEKAVTRRAKVAPAERMSKFLRHFTVVGDDYHAWNINYKKWENEEEEEEEEQPPPTPVSGEEGRAA APDVAPAPGPAPRAPLDFRGMLRKLFSSHRFQVIIICLVVLDALLVLAELILDLKIIQPDKNNYAAMVFH YMSITILVFFMMEIIFKLFVFRLEFFHHKFEILDAVVVVVSFILDIVLLFQEHQFEALGLLILLRLWRVA RIINGIIISVKTRSERQLLRLKQMNVQLAAKIQHLEFSCSEKEQEIERLNKLLRQHGLLGEVN myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_115745 |
RefSeq Size | 1727 |
RefSeq ORF | 819 |
Synonyms | HV1; VSOP |
Locus ID | 84329 |
Cytogenetics | 12q24.11 |
Summary | This gene encodes a voltage-gated protein channel protein expressed more highly in certain cells of the immune system. Phagocytic cells produce superoxide anions which require this channel protein, and in B cells this same process facilitates antibody production. This same channel protein, however, can also regulate functions in other cells including spermatozoa. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2012] |
Protein Families | Druggable Genome, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410163 | HVCN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC421678 | HVCN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY410163 | Transient overexpression lysate of hydrogen voltage-gated channel 1 (HVCN1), transcript variant 2 |
CNY 3080.00 |
|
LY421678 | Transient overexpression lysate of hydrogen voltage-gated channel 1 (HVCN1), transcript variant 1 |
CNY 3080.00 |
|
TP319422 | Recombinant protein of human hydrogen voltage-gated channel 1 (HVCN1), transcript variant 2, 20 µg |
CNY 2900.00 |